Property Summary

NCBI Gene PubMed Count 155
Grant Count 105
R01 Count 62
Funding $8,744,871.41
PubMed Score 753.37
PubTator Score 416.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma -2.900 0.000
cystic fibrosis -3.553 0.000
periodontitis 1.400 0.000
non-small cell lung carcinoma 2.300 0.000
lung cancer 4.800 0.000
lung adenocarcinoma 3.200 0.000
psoriasis 3.500 0.000

Synonym

Accession Q07973 Q15807 Q32ML3 Q5I2W7 24-OHase
Symbols CP24
HCAI
CYP24
HCINF1
P450-CC24

Gene

PANTHER Protein Class (2)

Gene RIF (137)

PMID Text
26997443 CYP24A1 expression is closely associated with colorectal cancer progression, and it might be a novel prognostic biomarker for CRC.
26766742 Results indicate that rs964293 modifies the association between estrogen and progestogen postmenopausal hormone replacement therapy and colorectal cancer risk. [Meta-Analysis]
26241700 The CYP24A1 SNP rs927650 may be related to both circulating blood concentrations of 25-hydroxyvitamin D as well as to odds of recurrent colorectal neoplasia.
26214117 CYP24A1 biallelic mutations are frequently found in patients presenting with hypercalcemia, low PTH, and renal disease. Haploinsufficiency is not associated with CYP24A1 deficiency.
26117226 most heterozygous CYP24A1 mutation carriers have a normal 25OHD/24,25(OH)2D ratio, are usually asymptomatic and have a normal skeletal status but may possibly be at increased risk of nephrocalcinosis
25727742 Human and rat CYP24A1 metabolize 20-hydroxyvitamin D3 to the same dihydroxyvitamin D3 products.
25596923 Data suggest that expression of CYP24A1 and cathelicidin is up-regulated in placental extravillous trophoblasts by vitamin D metabolites 1,23-dihydroxyvitamin D3 and 25-hydroxyvitamin D3.
25544771 Data show that cytochrome P450 CYP27B1 and CYP24A1 expression were significantly different between tumor and normal tissues in non-small cell lung cancer (NSCLC).
25488826 Vitamin D-binding protein SNPs are associated with prostate cancer; low 25(OH)D metabolism score and CYP24A1 and CYP27B1 variants are associated with grade
25446019 Hypercalcemia occurred during the sunlight exposure in patients with impaired 24-hydroxylation of vitamin D due to CYP24A1 mutations.
More...

AA Sequence

MSSPISKSRSLAAFLQQLRSPRQPPRLVTSTAYTSPQPREVPVCPLTAGGETQNAAALPGPTSWPLLGSL      1 - 70
LQILWKGGLKKQHDTLVEYHKKYGKIFRMKLGSFESVHLGSPCLLEALYRTESAYPQRLEIKPWKAYRDY     71 - 140
RKEGYGLLILEGEDWQRVRSAFQKKLMKPGEVMKLDNKINEVLADFMGRIDELCDERGHVEDLYSELNKW    141 - 210
SFESICLVLYEKRFGLLQKNAGDEAVNFIMAIKTMMSTFGRMMVTPVELHKSLNTKVWQDHTLAWDTIFK    211 - 280
SVKACIDNRLEKYSQQPSADFLCDIYHQNRLSKKELYAAVTELQLAAVETTANSLMWILYNLSRNPQVQQ    281 - 350
KLLKEIQSVLPENQVPRAEDLRNMPYLKACLKESMRLTPSVPFTTRTLDKATVLGEYALPKGTVLMLNTQ    351 - 420
VLGSSEDNFEDSSQFRPERWLQEKEKINPFAHLPFGVGKRMCIGRRLAELQLHLALCWIVRKYDIQATDN    421 - 490
EPVEMLHSGTLVPSRELPIAFCQR                                                  491 - 514
//

Text Mined References (157)

PMID Year Title
26997443 2016 CYP24A1 is a potential biomarker for the progression and prognosis of human colorectal cancer.
26766742 2016 CYP24A1 variant modifies the association between use of oestrogen plus progestogen therapy and colorectal cancer risk.
26241700 2015 CYP24A1 and CYP27B1 Polymorphisms, Concentrations of Vitamin D Metabolites, and Odds of Colorectal Adenoma Recurrence.
26214117 2015 CYP24A1 Mutations in a Cohort of Hypercalcemic Patients: Evidence for a Recessive Trait.
26117226 2015 Calcium and bone homeostasis in heterozygous carriers of CYP24A1 mutations: A cross-sectional study.
25727742 2015 Metabolism of 20-hydroxyvitamin D3 and 20,23-dihydroxyvitamin D3 by rat and human CYP24A1.
25596923 2015 Vitamin D promotes human extravillous trophoblast invasion in vitro.
25544771 2015 Genetic polymorphisms in the vitamin D pathway in relation to lung cancer risk and survival.
25488826 2015 Associations of vitamin D pathway genes with circulating 25-hydroxyvitamin-D, 1,25-dihydroxyvitamin-D, and prostate cancer: a nested case-control study.
25446019 2015 Kidney function and influence of sunlight exposure in patients with impaired 24-hydroxylation of vitamin D due to CYP24A1 mutations.
More...