Property Summary

Ligand Count 43
NCBI Gene PubMed Count 168
PubMed Score 825.91
PubTator Score 416.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count P-value
psoriasis 6694 3.5e-148
periodontitis 293 1.5e-28
cystic fibrosis 1696 4.3e-07
malignant mesothelioma 3232 6.3e-06
non-small cell lung cancer 2890 1.2e-05
lung adenocarcinoma 2716 7.9e-05
lung cancer 4740 5.2e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Atopic dermatitis 952 0.0 3.0
Multiple Sclerosis 540 0.0 3.0

Expression

  Differential Expression (7)

Disease log2 FC p
cystic fibrosis -3.553 4.3e-07
lung adenocarcinoma 1.700 7.9e-05
lung cancer 1.700 5.2e-04
malignant mesothelioma -2.900 6.3e-06
non-small cell lung cancer 1.292 1.2e-05
periodontitis 1.400 1.5e-28
psoriasis 3.500 3.5e-148

Gene RIF (150)

AA Sequence

MSSPISKSRSLAAFLQQLRSPRQPPRLVTSTAYTSPQPREVPVCPLTAGGETQNAAALPGPTSWPLLGSL      1 - 70
LQILWKGGLKKQHDTLVEYHKKYGKIFRMKLGSFESVHLGSPCLLEALYRTESAYPQRLEIKPWKAYRDY     71 - 140
RKEGYGLLILEGEDWQRVRSAFQKKLMKPGEVMKLDNKINEVLADFMGRIDELCDERGHVEDLYSELNKW    141 - 210
SFESICLVLYEKRFGLLQKNAGDEAVNFIMAIKTMMSTFGRMMVTPVELHKSLNTKVWQDHTLAWDTIFK    211 - 280
SVKACIDNRLEKYSQQPSADFLCDIYHQNRLSKKELYAAVTELQLAAVETTANSLMWILYNLSRNPQVQQ    281 - 350
KLLKEIQSVLPENQVPRAEDLRNMPYLKACLKESMRLTPSVPFTTRTLDKATVLGEYALPKGTVLMLNTQ    351 - 420
VLGSSEDNFEDSSQFRPERWLQEKEKINPFAHLPFGVGKRMCIGRRLAELQLHLALCWIVRKYDIQATDN    421 - 490
EPVEMLHSGTLVPSRELPIAFCQR                                                  491 - 514
//

Text Mined References (170)

PMID Year Title