Property Summary

NCBI Gene PubMed Count 52
PubMed Score 99.34
PubTator Score 101.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytoma 1.300 1.6e-02
dermatomyositis 1.500 2.5e-03
diabetes mellitus -1.500 2.2e-03
osteosarcoma 3.395 2.1e-07

Gene RIF (18)

AA Sequence

MDPLSELQDDLTLDDTSEALNQLKLASIDEKNWPSDEMPDFPKSDDSKSSSPELVTHLKWDDPYYDIARH      1 - 70
QIVEVAGDDKYGRKIIVFSACRMPPSHQLDHSKLLGYLKHTLDQYVESDYTLLYLHHGLTSDNKPSLSWL     71 - 140
RDAYREFDRKYKKNIKALYIVHPTMFIKTLLILFKPLISFKFGQKIFYVNYLSELSEHVKLEQLGIPRQV    141 - 210
LKYDDFLKSTQKSPATAPKPMPPRPPLPNQQFGVSLQHLQEKNPEQEPIPIVLRETVAYLQAHALTTEGI    211 - 280
FRRSANTQVVREVQQKYNMGLPVDFDQYNELHLPAVILKTFLRELPEPLLTFDLYPHVVGFLNIDESQRV    281 - 350
PATLQVLQTLPEENYQVLRFLTAFLVQISAHSDQNKMTNTNLAVVFGPNLLWAKDAAITLKAINPINTFT    351 - 420
KFLLDHQGELFPSPDPSGL                                                       421 - 439
//

Text Mined References (63)

PMID Year Title