Property Summary

NCBI Gene PubMed Count 49
Grant Count 110
R01 Count 76
Funding $7,430,434.77
PubMed Score 96.85
PubTator Score 101.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma 3.395 0.000
astrocytoma 1.300 0.016
diabetes mellitus -1.500 0.002
dermatomyositis 1.500 0.003

Synonym

Accession Q07960 D3DQQ6
Symbols RHOGAP
RHOGAP1
CDC42GAP
p50rhoGAP

Gene

PANTHER Protein Class (2)

PDB

1OW3   1TX4   1AM4   1GRN   1RGP   2NGR  

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
652148 confirmatory 0 / 0 / 47 Biochemical RhoGAP selectivity assay - p50RhoGAP

Gene RIF (15)

PMID Text
24086303 study shows that HMHA1 acts as a RhoGAP to regulate GTPase activity, cytoskeletal remodeling and cell spreading, which are crucial functions in normal hematopoietic and cancer cells
23684608 The interaction of RhoGap protein stabilizes the tetrameric conformation of p53 and enhances its DNA-binding activity, thereby inducing cell-cycle arrest and apoptosis.
23200924 In PC3 cells, ARHGAP21 presented GAP activity for RhoA and RhoC and induced changes in cell morphology. Moreover, its silencing altered the expression of genes involved in cell proliferation and cytoskeleton organization
23175628 RhoGAP Stard13 temporally and spatially regulates Rho activity in the developing pancreas to ensure that morphogenesis and establishment of tissue architecture are coordinated with organ growth.
21169361 PA and Rap1 cooperatively regulate RA-RhoGAP activity for promoting neurite outgrowth.
21051874 Rho proteins and ROK play a pivotal role in this signaling cascade
19911011 Observational study of gene-disease association. (HuGE Navigator)
19103606 ET-1 induces Rho-kinase activation and subsequent phosphorylation of p190A RhoGAP, leading to prolonged RhoA activation.
19066281 Results show that phorbol-ester-induced activation of protein kinases C and D stimulates association of DLC1 with 14-3-3 adaptor proteins, inhibiting RhoGAP activity and blocking nucleocytoplasmic transfer.
18619034 two potential interaction partners of Prx6: the calcium-activated cysteine endopeptidase calpain and the p50RhoGAP protein of the family of Sec14-like proteins.
More...

AA Sequence

MDPLSELQDDLTLDDTSEALNQLKLASIDEKNWPSDEMPDFPKSDDSKSSSPELVTHLKWDDPYYDIARH      1 - 70
QIVEVAGDDKYGRKIIVFSACRMPPSHQLDHSKLLGYLKHTLDQYVESDYTLLYLHHGLTSDNKPSLSWL     71 - 140
RDAYREFDRKYKKNIKALYIVHPTMFIKTLLILFKPLISFKFGQKIFYVNYLSELSEHVKLEQLGIPRQV    141 - 210
LKYDDFLKSTQKSPATAPKPMPPRPPLPNQQFGVSLQHLQEKNPEQEPIPIVLRETVAYLQAHALTTEGI    211 - 280
FRRSANTQVVREVQQKYNMGLPVDFDQYNELHLPAVILKTFLRELPEPLLTFDLYPHVVGFLNIDESQRV    281 - 350
PATLQVLQTLPEENYQVLRFLTAFLVQISAHSDQNKMTNTNLAVVFGPNLLWAKDAAITLKAINPINTFT    351 - 420
KFLLDHQGELFPSPDPSGL                                                       421 - 439
//

Text Mined References (60)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24086303 2013 The human minor histocompatibility antigen 1 is a RhoGAP.
23684608 2013 RhoGAPs attenuate cell proliferation by direct interaction with p53 tetramerization domain.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23200924 2013 ARHGAP21 is a RhoGAP for RhoA and RhoC with a role in proliferation and migration of prostate adenocarcinoma cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23175628 2013 Rho signalling restriction by the RhoGAP Stard13 integrates growth and morphogenesis in the pancreas.
More...