Property Summary

NCBI Gene PubMed Count 189
PubMed Score 772.57
PubTator Score 585.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Gene RIF (111)

AA Sequence

MSGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDA      1 - 70
VYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDH     71 - 140
MREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSR    141 - 210
SRSRSRSRSNSRSRSYSPRRSRGSPRYSPRHSRSRSRT                                    211 - 248
//

Text Mined References (203)

PMID Year Title