Property Summary

NCBI Gene PubMed Count 180
Grant Count 124
R01 Count 74
Funding $16,790,000.47
PubMed Score 756.29
PubTator Score 585.94

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q07955 B2R6Z7 D3DTZ3 Q13809
Symbols ASF
SF2
SFRS1
SF2p33
SRp30a

Gene

PDB

4C0O   3BEG   1X4A   2M7S   2M8D   2O3D  

Gene RIF (110)

PMID Text
27093186 results strongly support SRSF1 as a prognostic biomarker in SCLC and provide a rationale for personalized therapy in SCLC
26797131 NSrp70 acts as a new molecular counterpart for alternative splicing of target RNA, counteracting SRSF1 and SRSF2 splicing activity.
26596376 These findings have revealed a molecular interplay between cellular SRSF1 and viral T-antigen in controlling JC virus gene expression.
26553431 we have identified for the first time a potential mechanism that involves the essential splicing factor ASF/SF2 through which morphine regulates splicing specificity of the MOR encoding gene, OPRM1.
26431027 Using RNA-sequencing and 3-D cell cultures that mimic breast cancer, the authors identified SRSF1-regulated alternative splicing targets that are candidates for mediating SRSF1's oncogenic functions in mammary cells.
26406946 We present experimental evidence that splicing factor SRSF1, SRSF2, U2AF35, U2AF65 and KHSRP expression levels in gastrointestinal tract (colon, gastric and pancreatic) tumors differ compare to healthy tissues and in cell lines
26282582 Global splicing analysis with RNA-seq revealed that exons carrying the hnRNP H-binding GGGGG motif are predisposed to be skipped compared to those carrying the SRSF1-binding GGAGG motif in both human and mouse brains.
26273603 These include alternative splicing of SRSF1 itself.
26134847 SRSF1 regulates CD3zeta expression in human T cells and may contribute to the T cell defect in systemic lupus erythematosus.
26018840 SF2 contributes to the elevated levels of ERK activation in hepatocellular carcinoma cells through modulating key component(s) downstream of growth factor receptors and upstream of ERK.
More...

AA Sequence

MSGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDA      1 - 70
VYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDH     71 - 140
MREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSR    141 - 210
SRSRSRSRSNSRSRSYSPRRSRGSPRYSPRHSRSRSRT                                    211 - 248
//

Text Mined References (192)

PMID Year Title
27093186 2016 Genomic Landscape Survey Identifies SRSF1 as a Key Oncodriver in Small Cell Lung Cancer.
26797131 2016 Nuclear Speckle-related Protein 70 Binds to Serine/Arginine-rich Splicing Factors 1 and 2 via an Arginine/Serine-like Region and Counteracts Their Alternative Splicing Activity.
26596376 2015 Molecular interplay between T-Antigen and splicing factor, arginine/serine-rich 1 (SRSF1) controls JC virus gene expression in glial cells.
26553431 2016 Morphine-induced MOR-1X and ASF/SF2 Expressions Are Independent of Transcriptional Regulation: Implications for MOR-1X Signaling.
26431027 2015 SRSF1-Regulated Alternative Splicing in Breast Cancer.
26406946 2015 Gastrointestinal tract tumors and cell lines possess differential splicing factor expression and tumor associated mRNA isoform formation profiles.
26282582 2015 SRSF1 and hnRNP H antagonistically regulate splicing of COLQ exon 16 in a congenital myasthenic syndrome.
26273603 2015 Posttranscriptional Regulation of Splicing Factor SRSF1 and Its Role in Cancer Cell Biology.
26134847 2015 Serine Arginine-Rich Splicing Factor 1 (SRSF1) Contributes to the Transcriptional Activation of CD3? in Human T Cells.
26018840 2015 Splicing factor 2/alternative splicing factor contributes to extracellular signal?regulated kinase activation in hepatocellular carcinoma cells.
More...