Property Summary

NCBI Gene PubMed Count 79
Grant Count 37
R01 Count 21
Funding $7,354,881.26
PubMed Score 88.39
PubTator Score 97.04

Knowledge Summary

Patent (12,981)

Expression

  Differential Expression (6)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (48)

PMID Text
26677978 Authors identified tyrosine kinase nonreceptor 2 (TNK2) point mutations that exhibited oncogenic capacity.
26621748 that the cdc42-activated, nonreceptor tyrosine kinase, Ack1, is a DAT endocytic brake that stabilizes DAT at the plasma membrane.
26595808 TNK2 (and TNR) harbored rare, genetic variants in individuals with familial Parkinson's Disease.
26536663 Ack1 overexpression promotes metastasis in hepatocellular carcinoma.
25945695 Results found that the expression of ACK1 was significantly up-regulated in non-small-cell lung cancer (NSCLC) samples and demonstrate that ACK1 played an oncogenic role in the progression of NSCLC.
25738261 Our results indicate that ACK1 is an independent prognostic marker and promotes hepatocellular carcinoma progression
25678401 ACK1 promotes EMT, migration, and invasion by activating AKT-POU2F1-ECD signalling in Gastric cancer cells. ACK1 may be employed as a new prognostic factor and therapeutic target for gastric cancer.
25445114 expression of Ack1 plays an important role as predictor of recurrence and poor outcome in hepatocellular carcinoma patients.
25427824 We uncovered ten new mutations in TNK2 and DDR1 within serous and endometrioid ECs, thus providing novel insights into the mutation spectrum of each gene in EC.
25347744 Studies indicate that activated CDC42 kinase 1 (ACK1) interacts with the estrogen receptor (ER) and regulates the activity of androgen receptor (AR) to promote the growth of breast cancer and prostate cancer.
More...

AA Sequence

MQPEEGTGWLLELLSEVQLQQYFLRLRDDLNVTRLSHFEYVKNEDLEKIGMGRPGQRRLWEAVKRRKALC      1 - 70
KRKSWMSKVFSGKRLEAEFPPHHSQSTFRKTSPAPGGPAGEGPLQSLTCLIGEKDLRLLEKLGDGSFGVV     71 - 140
RRGEWDAPSGKTVSVAVKCLKPDVLSQPEAMDDFIREVNAMHSLDHRNLIRLYGVVLTPPMKMVTELAPL    141 - 210
GSLLDRLRKHQGHFLLGTLSRYAVQVAEGMGYLESKRFIHRDLAARNLLLATRDLVKIGDFGLMRALPQN    211 - 280
DDHYVMQEHRKVPFAWCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERL    281 - 350
PRPEDCPQDIYNVMVQCWAHKPEDRPTFVALRDFLLEAQPTDMRALQDFEEPDKLHIQMNDVITVIEGRA    351 - 420
ENYWWRGQNTRTLCVGPFPRNVVTSVAGLSAQDISQPLQNSFIHTGHGDSDPRHCWGFPDRIDELYLGNP    421 - 490
MDPPDLLSVELSTSRPPQHLGGVKKPTYDPVSEDQDPLSSDFKRLGLRKPGLPRGLWLAKPSARVPGTKA    491 - 560
SRGSGAEVTLIDFGEEPVVPALRPCAPSLAQLAMDACSLLDETPPQSPTRALPRPLHPTPVVDWDARPLP    561 - 630
PPPAYDDVAQDEDDFEICSINSTLVGAGVPAGPSQGQTNYAFVPEQARPPPPLEDNLFLPPQGGGKPPSS    631 - 700
AQTAEIFQALQQECMRQLQAPAGSPAPSPSPGGDDKPQVPPRVPIPPRPTRPHVQLSPAPPGEEETSQWP    701 - 770
GPASPPRVPPREPLSPQGSRTPSPLVPPGSSPLPPRLSSSPGKTMPTTQSFASDPKYATPQVIQAPGPRA    771 - 840
GPCILPIVRDGKKVSSTHYYLLPERPSYLERYQRFLREAQSPEEPTPLPVPLLLPPPSTPAPAAPTATVR    841 - 910
PMPQAALDPKANFSTNNSNPGARPPPPRATARLPQRGCPGDGPEAGRPADKIQMAMVHGVTTEECQAALQ    911 - 980
CHGWSVQRAAQYLKVEQLFGLGLRPRGECHKVLEMFDWNLEQAGCHLLGSWGPAHHKR                981 - 1038
//

Text Mined References (88)

PMID Year Title
26677978 2016 Identification and Characterization of Tyrosine Kinase Nonreceptor 2 Mutations in Leukemia through Integration of Kinase Inhibitor Screening and Genomic Analysis.
26621748 2015 Ack1 is a dopamine transporter endocytic brake that rescues a trafficking-dysregulated ADHD coding variant.
26595808 2016 Whole-Exome Sequencing in Familial Parkinson Disease.
26536663 2015 Ack1 overexpression promotes metastasis and indicates poor prognosis of hepatocellular carcinoma.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25945695 2016 Activated cdc42-associated kinase is up-regulated in non-small-cell lung cancer and necessary for FGFR-mediated AKT activation.
25738261 2015 ACK1 promotes hepatocellular carcinoma progression via downregulating WWOX and activating AKT signaling.
25678401 2015 ACK1 promotes gastric cancer epithelial-mesenchymal transition and metastasis through AKT-POU2F1-ECD signalling.
25445114 2014 Overexpression of activated Cdc42-associated kinase1 (Ack1) predicts tumor recurrence and poor survival in human hepatocellular carcinoma.
25427824 2014 Mutational analysis of the tyrosine kinome in serous and clear cell endometrial cancer uncovers rare somatic mutations in TNK2 and DDR1.
More...