Property Summary

NCBI Gene PubMed Count 33
Grant Count 19
R01 Count 18
Funding $2,150,079.56
PubMed Score 32.50
PubTator Score 21.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Rheumatoid Arthritis 1.100 0.021
Multiple myeloma 1.034 0.011
cutaneous lupus erythematosus -1.100 0.017
psoriasis -3.800 0.000
osteosarcoma -2.530 0.000
ependymoma 1.100 0.000
group 4 medulloblastoma 2.000 0.000
atypical teratoid / rhabdoid tumor 1.200 0.000
glioblastoma 1.100 0.023
hereditary spastic paraplegia -1.081 0.009
ulcerative colitis -1.100 0.002
ovarian cancer -1.600 0.000
Gaucher disease type 1 -1.400 0.016
dermatomyositis -1.600 0.001

 MGI Term (1)

Gene RIF (8)

PMID Text
26173643 Activating Mutations Affecting the Dbl Homology Domain of SOS2 Cause Noonan Syndrome
25795793 We identified two novel genes, SOS2 and LZTR1, associated with Noonan syndrome, thereby expanding the molecular spectrum of RASopathies.
23761422 multicenter pharmacogenetic study in children (ages 6-11): Data suggest that SNP in SOS2 (rs13379306) in children with growth hormone deficiency is associated with drug resistance to hormone replacement therapy with recombinant human growth hormone.
20618341 intracellular Francisella tularensis novicida triggers temporal and early activation of Ras through the SOS2/GrB2/PKCalpha/PKCbetaI quaternary complex; Ras signalling by intracellular F. tularensis is essential for intracellular proliferation in the cytosol
19911011 Observational study of gene-disease association. (HuGE Navigator)
19289468 Loss of MADD expression resulted in reduced Grb2 and Sos1/2 recruitment to the TNFR1 complex and decreased Ras and MEKK1/2 activation
17440948 Observational study of gene-disease association. (HuGE Navigator)
17440948 Significant association of single nucleotide polymorphism within three genes--PPARgamma, SOS2, and PCK1--with Alzheimer's disease, was confirmed.

AA Sequence

MQQAPQPYEFFSEENSPKWRGLLVSALRKVQEQVHPTLSANEESLYYIEELIFQLLNKLCMAQPRTVQDV      1 - 70
EERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPSLKEVLGYKVDYHVSLYIVAVLEYISAD     71 - 140
ILKLAGNYVFNIRHYEISQQDIKVSMCADKVLMDMFDQDDIGLVSLCEDEPSSSGELNYYDLVRTEIAEE    141 - 210
RQYLRELNMIIKVFREAFLSDRKLFKPSDIEKIFSNISDIHELTVKLLGLIEDTVEMTDESSPHPLAGSC    211 - 280
FEDLAEEQAFDPYETLSQDILSPEFHEHFNKLMARPAVALHFQSIADGFKEAVRYVLPRLMLVPVYHCWH    281 - 350
YFELLKQLKACSEEQEDRECLNQAITALMNLQGSMDRIYKQYSPRRRPGDPVCPFYSHQLRSKHLAIKKM    351 - 420
NEIQKNIDGWEGKDIGQCCNEFIMEGPLTRIGAKHERHIFLFDGLMISCKPNHGQTRLPGYSSAEYRLKE    421 - 490
KFVMRKIQICDKEDTCEHKHAFELVSKDENSIIFAAKSAEEKNNWMAALISLHYRSTLDRMLDSVLLKEE    491 - 560
NEQPLRLPSPEVYRFVVKDSEENIVFEDNLQSRSGIPIIKGGTVVKLIERLTYHMYADPNFVRTFLTTYR    561 - 630
SFCKPQELLSLLIERFEIPEPEPTDADKLAIEKGEQPISADLKRFRKEYVQPVQLRILNVFRHWVEHHFY    631 - 700
DFERDLELLERLESFISSVRGKAMKKWVESIAKIIRRKKQAQANGVSHNITFESPPPPIEWHISKPGQFE    701 - 770
TFDLMTLHPIEIARQLTLLESDLYRKVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVEA    771 - 840
ENFEERVAVLSRIIEILQVFQDLNNFNGVLEIVSAVNSVSVYRLDHTFEALQERKRKILDEAVELSQDHF    841 - 910
KKYLVKLKSINPPCVPFFGIYLTNILKTEEGNNDFLKKKGKDLINFSKRRKVAEITGEIQQYQNQPYCLR    911 - 980
IEPDMRRFFENLNPMGSASEKEFTDYLFNKSLEIEPRNCKQPPRFPRKSTFSLKSPGIRPNTGRHGSTSG    981 - 1050
TLRGHPTPLEREPCKISFSRIAETELESTVSAPTSPNTPSTPPVSASSDLSVFLDVDLNSSCGSNSIFAP   1051 - 1120
VLLPHSKSFFSSCGSLHKLSEEPLIPPPLPPRKKFDHDASNSKGNMKSDDDPPAIPPRQPPPPKVKPRVP   1121 - 1190
VPTGAFDGPLHSPPPPPPRDPLPDTPPPVPLRPPEHFINCPFNLQPPPLGHLHRDSDWLRDISTCPNSPS   1191 - 1260
TPPSTPSPRVPRRCYVLSSSQNNLAHPPAPPVPPRQNSSPHLPKLPPKTYKRELSHPPLYRLPLLENAET   1261 - 1330
PQ                                                                       1331 - 1332
//

Text Mined References (35)

PMID Year Title
26173643 2015 Activating Mutations Affecting the Dbl Homology Domain of SOS2 Cause Noonan Syndrome.
25795793 2015 Rare variants in SOS2 and LZTR1 are associated with Noonan syndrome.
24347629 2014 Genome-wide association study of periodontal health measured by probing depth in adults ages 18-49 years.
23761422 2013 A pharmacogenomic approach to the treatment of children with GH deficiency or Turner syndrome.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21706016 2011 Selected reaction monitoring mass spectrometry reveals the dynamics of signaling through the GRB2 adaptor.
20936779 2010 A human MAP kinase interactome.
20618341 2010 Triggering Ras signalling by intracellular Francisella tularensis through recruitment of PKC? and ?I to the SOS2/GrB2 complex is essential for bacterial proliferation in the cytosol.
19911011 2010 Mutation of ARHGAP9 in patients with coronary spastic angina.
19380743 2009 Charting the molecular network of the drug target Bcr-Abl.
More...