Property Summary

NCBI Gene PubMed Count 160
Grant Count 104
R01 Count 67
Funding $8,706,371
PubMed Score 426.61
PubTator Score 277.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Synonym

Accession Q07889 A8K2G3 B4DXG2 SOS-1
Symbols GF1
HGF
NS4
GGF1
GINGF

Gene

PDB

1BKD   1NVU   1NVV   1NVW   1NVX   1XD2   4NYI   4NYJ   4NYM   4URU   4URV   4URW   4URX   4URY   4URZ   4US0   4US1   4US2   1AWE   1DBH   1Q9C   1XD4   1XDV   2II0   3KSY  

 GWAS Trait (1)

Gene RIF (82)

PMID Text
26565026 Ras.GDP weakly binds to the catalytic but not to the allosteric site of Sos.
26447228 findings suggest that targeting the Src/Abl/Sos1/Rac pathway may represent a double-edged sword to control both cancer-invasive capacities and cancer-related inflammation.
26077951 rs963731 is associated with corticobasal degeneration.
25980493 In non-apoptotic cells, nuclear EGFR induced SOS1 expression by directly binding to the SOS1 promoter.
25825487 Combined rational design and a high throughput screening platform for identifying chemical inhibitors of a Ras-activating enzyme.
25712082 The present study provides a first evidence of allelic imbalance of SOS1 and pinpoints this condition as a possible mechanism underlying a different penetrance of some SOS1-mutated alleles in unrelated carriers
25624485 Stabilized alpha helices of son of sevenless 1 directly inhibit wild-type and mutant forms of KRAS.
25469565 These data demonstrated the negative regulation between miR-146a and SOS1 and between miR-370 and GADD45beta and that these regulations are influenced by enterovirus 71 to induce apoptosis.
25394671 SOS1 and Ras regulate epithelial tight junction formation in the human airway through EMP1.
25071181 Increased expression of SOS1 increases NFkappaB activation in several types of cancer cells, and ablation of SOS1 inhibits EGF-induced NFkappaB activation in these cells, indicating that SOS1 is a component of the pathway connecting EGFR to NFkappaB activation.
More...

AA Sequence

MQAQQLPYEFFSEENAPKWRGLLVPALKKVQGQVHPTLESNDDALQYVEELILQLLNMLCQAQPRSASDV      1 - 70
EERVQKSFPHPIDKWAIADAQSAIEKRKRRNPLSLPVEKIHPLLKEVLGYKIDHQVSVYIVAVLEYISAD     71 - 140
ILKLVGNYVRNIRHYEITKQDIKVAMCADKVLMDMFHQDVEDINILSLTDEEPSTSGEQTYYDLVKAFMA    141 - 210
EIRQYIRELNLIIKVFREPFVSNSKLFSANDVENIFSRIVDIHELSVKLLGHIEDTVEMTDEGSPHPLVG    211 - 280
SCFEDLAEELAFDPYESYARDILRPGFHDRFLSQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLAPVYHC    281 - 350
LHYFELLKQLEEKSEDQEDKECLKQAITALLNVQSGMEKICSKSLAKRRLSESACRFYSQQMKGKQLAIK    351 - 420
KMNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQPRLPGASNAEYRL    421 - 490
KEKFFMRKVQINDKDDTNEYKHAFEIILKDENSVIFSAKSAEEKNNWMAALISLQYRSTLERMLDVTMLQ    491 - 560
EEKEEQMRLPSADVYRFAEPDSEENIIFEENMQPKAGIPIIKAGTVIKLIERLTYHMYADPNFVRTFLTT    561 - 630
YRSFCKPQELLSLIIERFEIPEPEPTEADRIAIENGDQPLSAELKRFRKEYIQPVQLRVLNVCRHWVEHH    631 - 700
FYDFERDAYLLQRMEEFIGTVRGKAMKKWVESITKIIQRKKIARDNGPGHNITFQSSPPTVEWHISRPGH    701 - 770
IETFDLLTLHPIEIARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIV    771 - 840
ETENLEERVAVVSRIIEILQVFQELNNFNGVLEVVSAMNSSPVYRLDHTFEQIPSRQKKILEEAHELSED    841 - 910
HYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPEVLKRHGKELINFSKRRKVAEITGEIQQYQNQPYC    911 - 980
LRVESDIKRFFENLNPMGNSMEKEFTDYLFNKSLEIEPRNPKPLPRFPKKYSYPLKSPGVRPSNPRPGTM    981 - 1050
RHPTPLQQEPRKISYSRIPESETESTASAPNSPRTPLTPPPASGASSTTDVCSVFDSDHSSPFHSSNDTV   1051 - 1120
FIQVTLPHGPRSASVSSISLTKGTDEVPVPPPVPPRRRPESAPAESSPSKIMSKHLDSPPAIPPRQPTSK   1121 - 1190
AYSPRYSISDRTSISDPPESPPLLPPREPVRTPDVFSSSPLHLQPPPLGKKSDHGNAFFPNSPSPFTPPP   1191 - 1260
PQTPSPHGTRRHLPSPPLTQEVDLHSIAGPPVPPRQSTSQHIPKLPPKTYKREHTHPSMHRDGPPLLENA   1261 - 1330
HSS                                                                      1331 - 1333
//

Text Mined References (170)

PMID Year Title
26565026 2016 Monitoring Ras Interactions with the Nucleotide Exchange Factor Son of Sevenless (Sos) Using Site-specific NMR Reporter Signals and Intrinsic Fluorescence.
26447228 2015 Sos1 Regulates Macrophage Podosome Assembly and Macrophage Invasive Capacity.
26077951 2015 Genome-wide association study of corticobasal degeneration identifies risk variants shared with progressive supranuclear palsy.
25980493 2015 Nuclear EGFR impairs ASPP2-p53 complex-induced apoptosis by inducing SOS1 expression in hepatocellular carcinoma.
25825487 2015 Combined rational design and a high throughput screening platform for identifying chemical inhibitors of a Ras-activating enzyme.
25712082 2015 Differential allelic expression of SOS1 and hyperexpression of the activating SOS1 c.755C variant in a Noonan syndrome family.
25624485 2015 Direct inhibition of oncogenic KRAS by hydrocarbon-stapled SOS1 helices.
25469565 2015 miR-146a and miR-370 coordinate enterovirus 71-induced cell apoptosis through targeting SOS1 and GADD45?.
25394671 2015 SOS1 and Ras regulate epithelial tight junction formation in the human airway through EMP1.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
More...