Property Summary

NCBI Gene PubMed Count 486
Grant Count 764
R01 Count 440
Funding $115,320,309.56
PubMed Score 2399.72
PubTator Score 2697.10

Knowledge Summary

Patent (54,945)

TINX Plot

  Disease Relevance (65)

Disease Z-score Confidence
Lipid metabolism disorder 102 5.612 2.8
diabetes mellitus 1,663 5.483 2.7
Obesity 616 5.428 2.7
Atherosclerosis 275 5.129 2.6
Metabolic syndrome X 155 5.098 2.5
Fatty liver disease 84 4.881 2.4
Hyperglycemia 120 4.263 2.1
Cancer 2,346 3.58 1.8
Hypertension 287 3.555 1.8
Hyperinsulinism 63 3.399 1.7
Coronary artery disease 240 3.388 1.7
Liver disease 219 3.357 1.7
Heart disease 279 3.339 1.7
Abdominal obesity metabolic syndrome 2
Acute Kidney Tubular Necrosis 6
Adverse reaction to drug 54
Animal Mammary Neoplasms 136
Cardiomegaly 66
Crohn Disease 97
Dermatitis, Atopic 45
Diabetes Mellitus, Experimental 106
Diabetes Mellitus, Non-Insulin-Dependent 157
Diabetic dyslipidemia associated with ty... 2 
Drug-Induced Liver Injury 118
Dyslipidemias 17
Experimental Autoimmune Encephalomyeliti... 7 
Familial hypercholesterolemia - heterozy... 6 
Fatty Liver 48
Fatty Liver, Alcoholic 2
Hepatomegaly 10
Hypercholesterolemia 27
Hyperlipidemia 25
Hyperlipoproteinemias 6
Hypertensive disease 193
Hypertriglyceridemia 18
Hypoalphalipoproteinemia 3
Hypoglycemia 81
Inflammation 109
Insulin Resistance 48
Kidney Diseases 86
Kidney Failure, Chronic 45
Liver neoplasms 109
Mammary Neoplasms, Experimental 150
Mixed hyperlipidemia 5
Myocardial Reperfusion Injury 34
Myopathy 128
Non-alcoholic Fatty Liver Disease 40
Pick disease 1,893
Primary Prevention of Coronary Heart Dis... 4 
Prostatic Neoplasms 471
Proteinuria 63
Reperfusion Injury 84
atypical teratoid/rhabdoid tumor 1,095
breast carcinoma 1,614
ductal carcinoma in situ 1,745
group 3 medulloblastoma 2,254
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
medulloblastoma, large-cell 6,234
osteosarcoma 7,933
ovarian cancer 8,484
pancreatic ductal adenocarcinoma liver m... 1,795 
posterior fossa group B ependymoma 1,530
primitive neuroectodermal tumor 3,031

Expression

Synonym

Accession Q07869 B0G0X3 Q16241 Q6I9S0 Q92486 Q92689 Q9Y3N1 PPAR-alpha
Symbols PPAR
NR1C1
hPPAR
PPARalpha

Gene

PDB

1KKQ   3SP6   1I7G   1K7L   2NPA   2P54   2REW   2ZNN   3ET1   3FEI   3G8I   3KDT   3KDU   3VI8   4BCR   4CI4   5AZT  

 GO Component (2)

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
504735 confirmatory 3 / 0 / 3 Late stage assay provider counterscreen for partial agonists of the peroxisome proliferator-activated receptor gamma (PPARg): Luminescence-based cell-based dose response assay for partial agonists of the peroxisome proliferator-activated receptor alpha (PPARA).
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors

Gene RIF (458)

PMID Text
26775637 cPGI2 activates PPARalpha and PPARgamma, which act separately from IP-R to up-regulate the expression of key genes involved in the function of brite adipocytes.
26722456 PPAR-gamma and PTEN expressions are related to the clinical parameters and prognosis of renal cell carcinoma
26718439 PPAR agonists troglitazone and aleglitazar reverse doxorubicin resistance of human myelogenous leukemia cells.
26673968 No association was found between PPARalpha L162V single nucleotide polymorphisms with obesity and metabolic syndrome in a multi-ethnic population in Kampar, Malaysia.
26671025 There was no statistically significant difference in the distribution of PPARalpha Leu162Val polymorphism between the ischemic stroke patients and controls in the Han ethnic group.
26617775 Describe a renoprotective role of fenofibrate in albumin bound fatty acid associated tubular toxicity, involving the transcriptional activation of PPARalpha and suppression of NF-kB.
26577021 These results suggest that EPA inhibits intestinal beta-carotene absorption by down regulation of SR B1 expression via PPARalpha dependent mechanism and provide an evidence for dietary modulation of intestinal beta-carotene absorption.
26556865 PPARalpha functions as an E3 ubiquitin ligase to induce Bcl2 ubiquitination and degradation, leading to increased cancer cell sensitivity in response to chemotherapy drugs.
26497374 results support an important association between rs1800206 minor allele (V) of PPAR alpha and lower CRP level; the interaction analysis showed a combined effect between rs1800206 and rs135539 on the lower CRP level
26472199 Supplementation with the PPARalpha agonist WY14643 improved the homeostasis and barrier function of filaggrin deficient skin models by normalization of the free fatty acid profile.
More...

AA Sequence

MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVITD      1 - 70
TLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACEGCKGFFRRTIRLKLVYDKCD     71 - 140
RSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRI    141 - 210
YEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTS    211 - 280
VETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKP    281 - 350
FCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDI    351 - 420
FLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY                          421 - 468
//

Text Mined References (495)

PMID Year Title
26775637 2016 IP-receptor and PPARs trigger the conversion of human white to brite adipocyte induced by carbaprostacyclin.
26722456 2015 Prognostic role of PPAR-? and PTEN in the renal cell carcinoma.
26718439 2015 Differential effects of peroxisome proliferator-activated receptor agonists on doxorubicin-resistant human myelogenous leukemia (K562/DOX) cells.
26673968 2015 Screening of Peroxisome Proliferator-Activated Receptors (PPARs) ?, ? and ? Gene Polymorphisms for Obesity and Metabolic Syndrome Association in the Multi-Ethnic Malaysian Population.
26671025 2016 Functional Genetic Variants of PPARx03B3; and PPAR? Encoding Peroxisome Proliferator-Activated Receptors and Susceptibility to Ischemic Stroke in Chinese Han Population.
26617775 2015 Fenofibrate, a PPAR? agonist, protect proximal tubular cells from albumin-bound fatty acids induced apoptosis via the activation of NF-kB.
26577021 2016 Eicosapentaenoic acid inhibits intestinal ?-carotene absorption by downregulation of lipid transporter expression via PPAR-? dependent mechanism.
26556865 2015 PPAR? induces cell apoptosis by destructing Bcl2.
26504087 2015 Reactive Oxygen Species (ROS) Mediate p300-dependent STAT1 Protein Interaction with Peroxisome Proliferator-activated Receptor (PPAR)-? in CD36 Protein Expression and Foam Cell Formation.
26497374 2015 Study on association of peroxisome proliferator-activated receptor ? with C-reactive protein, and additional gene-gene interaction in Chinese Han.
More...