Property Summary

Ligand Count 377
NCBI Gene PubMed Count 516
PubMed Score 2457.85
PubTator Score 2697.10

Knowledge Summary

Patent (54,945)

TINX Plot

  Disease (5)

Expression

 GO Component (2)

Protein-protein Interaction (1)

PDB (18)

Gene RIF (486)

AA Sequence

MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVITD      1 - 70
TLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACEGCKGFFRRTIRLKLVYDKCD     71 - 140
RSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRI    141 - 210
YEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTS    211 - 280
VETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKP    281 - 350
FCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDI    351 - 420
FLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY                          421 - 468
//

Text Mined References (525)

PMID Year Title