Property Summary

NCBI Gene PubMed Count 49
Grant Count 69
R01 Count 58
Funding $11,964,914.18
PubMed Score 25.76
PubTator Score 42.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis 1.600 0.000
astrocytoma 1.500 0.009
atypical teratoid / rhabdoid tumor 1.200 0.000
glioblastoma 1.100 0.001
pancreatic ductal adenocarcinoma liver m... 1.320 0.004
ovarian cancer -1.500 0.000
dermatomyositis 1.100 0.000

Gene

PDB

3NF1  

 GWAS Trait (1)

Gene RIF (32)

PMID Text
25883527 The G allele and GG genotype of KLC1 rs8702 were significantly over-represented among cataract patients, as compared to healthy controls, and were associated with an odds ratio for cataract development.
25472445 BNIP-2 is a kinesin-1 adapter involved in vesicular transportation in the cytoplasm and that association with cargos depends on interaction of the CRAL-TRIO domain with membrane phosphatidylserine.
25209998 Microtubule-bound kinesin-1 and kinesin-3 motor domains were visualized at multiple steps in their ATPase cycles--including their nucleotide-free states--at approximately 7 A resolution using cryo-electron microscopy.
25082190 Dnm1L interacts with KLC1 through the tetratricopeptide repeat domains.
24497505 The expression levels of KLC1 variant E in brain and lymphocytes were significantly higher in Alzheimer's disease patients.
24116125 Studies indicate that FEZ1 (fasciculation and elongation protein zeta 1), SCOCO (short coiled-coil protein) and kinesins (kinesin heavy chain) are involved in biological transport process.
23776437 study provides evidence that the combined effect of three variants within the KLC1 gene may predispose to age-related cataract.
22470497 For the binding of cargos shared by KLC1, we propose a different site located within the groove but not involving N343.
22272245 Data suggest that KLC1 is required for normal neural differentiation, ensuring proper metabolism of AD-associated molecules APP and Tau and for proliferation of neural precursors (NPs).
21385839 Phosphorylation of KLC1 at serine 460 modulates binding and trafficking of calsyntenin-1.
More...

AA Sequence

MYDNMSTMVYIKEDKLEKLTQDEIISKTKQVIQGLEALKNEHNSILQSLLETLKCLKKDDESNLVEEKSN      1 - 70
MIRKSLEMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQKSEQSVAQ     71 - 140
LEEEKKHLEFMNQLKKYDDDISPSEDKDTDSTKEPLDDLFPNDEDDPGQGIQQQHSSAAAAAQQGGYEIP    141 - 210
ARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLND    211 - 280
ALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQ    281 - 350
NQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVD    351 - 420
DENKPIWMHAEEREECKGKQKDGTSFGEYGGWYKACKVDSPTVTTTLKNLGALYRRQGKFEAAETLEEAA    421 - 490
MRSRKQGLDNVHKQRVAEVLNDPENMEKRRSRESLNVDVVKYESGPDGGEEVSMSVEWNGGVSGRASFCG    491 - 560
KRQQQQWPGRRHR                                                             561 - 573
//

Text Mined References (59)

PMID Year Title
25898167 2015 BORC, a multisubunit complex that regulates lysosome positioning.
25883527 2015 The link between apolipoprotein E, presenilin 1, and kinesin light chain 1 gene polymorphisms and age-related cortical cataracts in the Chinese population.
25472445 2015 BNIP-2 binds phosphatidylserine, localizes to vesicles, and is transported by kinesin-1.
25416956 2014 A proteome-scale map of the human interactome network.
25209998 2014 Conserved mechanisms of microtubule-stimulated ADP release, ATP binding, and force generation in transport kinesins.
25082190 2014 Dynamin-1-like protein (Dnm1L) interaction with kinesin light chain 1 (KLC1) through the tetratricopeptide repeat (TPR) domains.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24497505 2014 Transcriptome analysis of distinct mouse strains reveals kinesin light chain-1 splicing as an amyloid-? accumulation modifier.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24116125 2013 Structural analysis of intermolecular interactions in the kinesin adaptor complex fasciculation and elongation protein zeta 1/ short coiled-coil protein (FEZ1/SCOCO).
More...