Property Summary

NCBI Gene PubMed Count 61
PubMed Score 401.76
PubTator Score 138.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Cystinuria 18 8.646 4.0
hypotonia-cystinuria syndrome 6 5.833 2.9
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Lysinuric protein intolerance 15 5.019 2.5
Hartnup disease 13 3.099 1.5
Disease Target Count
2p21 microdeletion syndrome 4

Expression

  Differential Expression (18)

Disease log2 FC p
active Crohn's disease -1.635 1.9e-03
astrocytic glioma -2.800 1.6e-02
atypical teratoid / rhabdoid tumor -1.700 2.9e-12
Barrett's esophagus 2.000 4.9e-02
ependymoma -2.900 2.8e-02
facioscapulohumeral dystrophy 2.400 4.7e-05
glioblastoma -1.200 6.9e-03
intraductal papillary-mucinous adenoma (... -3.600 7.6e-03
intraductal papillary-mucinous carcinoma... -4.000 2.0e-03
medulloblastoma -1.400 4.1e-04
medulloblastoma, large-cell -2.200 2.3e-06
nephrosclerosis -1.473 1.8e-02
oligodendroglioma -2.800 1.7e-02
osteosarcoma -1.346 3.2e-05
pancreatic cancer -1.500 3.0e-02
pediatric high grade glioma -1.100 6.0e-04
psoriasis -1.300 3.0e-04
ulcerative colitis -2.800 5.9e-04

 OMIM Phenotype (1)

Gene RIF (44)

AA Sequence

MAEDKSKRDSIEMSMKGCQTNNGFVHNEDILEQTPDPGSSTDNLKHSTRGILGSQEPDFKGVQPYAGMPK      1 - 70
EVLFQFSGQARYRIPREILFWLTVASVLVLIAATIAIIALSPKCLDWWQEGPMYQIYPRSFKDSNKDGNG     71 - 140
DLKGIQDKLDYITALNIKTVWITSFYKSSLKDFRYGVEDFREVDPIFGTMEDFENLVAAIHDKGLKLIID    141 - 210
FIPNHTSDKHIWFQLSRTRTGKYTDYYIWHDCTHENGKTIPPNNWLSVYGNSSWHFDEVRNQCYFHQFMK    211 - 280
EQPDLNFRNPDVQEEIKEILRFWLTKGVDGFSLDAVKFLLEAKHLRDEIQVNKTQIPDTVTQYSELYHDF    281 - 350
TTTQVGMHDIVRSFRQTMDQYSTEPGRYRFMGTEAYAESIDRTVMYYGLPFIQEADFPFNNYLSMLDTVS    351 - 420
GNSVYEVITSWMENMPEGKWPNWMIGGPDSSRLTSRLGNQYVNVMNMLLFTLPGTPITYYGEEIGMGNIV    421 - 490
AANLNESYDINTLRSKSPMQWDNSSNAGFSEASNTWLPTNSDYHTVNVDVQKTQPRSALKLYQDLSLLHA    491 - 560
NELLLNRGWFCHLRNDSHYVVYTRELDGIDRIFIVVLNFGESTLLNLHNMISGLPAKMRIRLSTNSADKG    561 - 630
SKVDTSGIFLDKGEGLIFEHNTKNLLHRQTAFRDRCFVSNRACYSSVLNILYTSC                   631 - 685
//

Text Mined References (65)

PMID Year Title