Property Summary

NCBI Gene PubMed Count 474
Grant Count 495
R01 Count 287
Funding $47,803,514.67
PubMed Score 1469.21
PubTator Score 1115.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (34)

Synonym

Accession Q07820 B2R6B2 D3DV03 D3DV04 Q9HD91 Q9NRQ3 Q9NRQ4 Q9UHR7 Q9UHR8 Q9UHR9 Q9UNJ1
Symbols TM
EAT
MCL1L
MCL1S
Mcl-1
BCL2L3
MCL1-ES
bcl2-L-3
mcl1/EAT

Gene

PANTHER Protein Class (1)

PDB

2KBW   5C3F   2NL9   3D7V   3IO9   3KJ0   3KJ1   3KJ2   4BPI   4BPJ   2MHS   2NLA   2PQK   3KZ0   3MK8   3PK1   3TWU   3WIX   3WIY   4HW2   4HW3   4HW4   4OQ5   4OQ6   4WGI   4WMR   4WMS   4WMT   4WMU   4WMV   4WMW   4WMX   4ZBF   4ZBI   5C6H   5FC4   5FDO   5FDR  

MLP Assay (17)

AID Type Active / Inconclusive / Inactive Description
1009 screening 196 / 446 / 194215 Multiplexed high-throughput screen for small molecule regulators of Bcl-2 family protein interactions, specifically Bim-Mcl-1
1021 screening 2130 / 0 / 216658 uHTS of Mcl-1/Bid interaction inhibitors
1022 screening 3336 / 0 / 214179 uHTS of Mcl-1/Noxa interaction inhibitors
1329 confirmatory 3 / 0 / 831 Multiplexed dose response screen for small molecule regulators of Bcl-2 family protein interactions, specifically Bim-Mcl-1.
1417 confirmatory 875 / 0 / 239 Dose Response Confirmation for Mcl-1/Noxa Interaction Inhibitors
1418 confirmatory 509 / 0 / 667 Dose Response Confirmation for Mcl-1/Bid Interaction Inhibitors
2057 screening 2141 / 0 / 312959 Fluorescence polarization-based primary biochemical high throughput screening assay to identify inhibitors of myeloid cell leukemia sequence 1 (MCL1) interactions with BIM-BH3 peptide.
2086 confirmatory 0 / 0 / 42 Confirmation dose response of hits from multiplexed high-throughput screen for small molecule regulators of Bcl-2 family protein interactions, specifically Bim-Mcl-1
2090 summary 0 / 0 / 0 Summary of probe development efforts to identify inhibitors of myeloid cell leukemia sequence 1 (MCL1) interactions with BIM-BH3 peptide.
2168 screening 1050 / 0 / 670 Fluorescence polarization-based biochemical high throughput confirmation assay for inhibitors of myeloid cell leukemia sequence 1 (MCL1) interactions with BIM-BH3 peptide.
More...

Gene RIF (436)

PMID Text
27455555 the FoxM1/Mcl-1 pathway may overcome cispaltin resistance of gastric cancer and provide a new therapeutic target for the treatment of gastric cancer
27063186 JAK3 and MCL-1 were down-regulated in patient CD8(+) T cells versus their normal counterparts, likely due to defective suppressor activity of miR-29b and miR-198 in RCC CD8(+) T cells.
27049076 Mcl-1 plays a fundamental role in the survival and resistance of U-937 cells to etoposide.
26921175 Our data demonstrate a critical role of Mcl-1 in Her2-positive BC cell survival under hypoxic conditions and provide the preclinical framework for the therapeutic use of novel Mcl-1- targeting agents to improve patient outcome in breast cancer .
26739047 The authors now show that human cytomegalovirus more robustly upregulated Mcl-1 than normal myeloid growth factors and that Mcl-1 was the only myeloid survival factor to rapidly induce HSP27 prior to the 48-h cell fate checkpoint.
26720004 Bay 61-3606 downregulates Mcl-1 expression in breast cancer cells and sensitizes cancer cells to TRAIL-mediated apoptosis.
26718267 miR-101 is a negative regulator of Mcl-1 in hepatocellular carcinoma.
26636651 identify high copy number gain of MCL1 (chromosome 1q) and loss of CDKN2A (P16, chromosome 9p) in metastatic BRAF
26610208 Bak activates upon loss of anti-apoptotic Bcl-XL and Mcl-1 but in the absence of active BH3-only proteins.
26540567 Bone marrow stroma-induced resistance of chronic lymphocytic leukemia cells to arsenic trioxide involves Mcl-1 upregulation and is overcome by inhibiting the PI3Kdelta or PKCbeta signaling pathways.
More...

AA Sequence

MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLT      1 - 70
PDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAV     71 - 140
LPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKAL    141 - 210
ETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKT    211 - 280
INQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR    281 - 350
//

Text Mined References (479)

PMID Year Title
27455555 2016 Knockdown of the FoxM1 enhances the sensitivity of gastric cancer cells to cisplatin by targeting Mcl-1.
27063186 2016 miR-29b and miR-198 overexpression in CD8+ T cells of renal cell carcinoma patients down-modulates JAK3 and MCL-1 leading to immune dysfunction.
27049076 Silencing of myeloid cell leukemia-1 by small interfering RNA improves chemosensitivity to etoposide in u-937 leukemic cells.
27013495 2016 The deubiquitinase Usp27x stabilizes the BH3-only protein Bim and enhances apoptosis.
26921175 2016 Mcl-1 confers protection of Her2-positive breast cancer cells to hypoxia: therapeutic implications.
26859456 2016 Exploitation of the Apoptosis-Primed State of MYCN-Amplified Neuroblastoma to Develop a Potent and Specific Targeted Therapy Combination.
26739047 2016 Human Cytomegalovirus Stimulates the Synthesis of Select Akt-Dependent Antiapoptotic Proteins during Viral Entry To Promote Survival of Infected Monocytes.
26720004 2015 Bay 61-3606 Sensitizes TRAIL-Induced Apoptosis by Downregulating Mcl-1 in Breast Cancer Cells.
26718267 2016 MicroRNA-101 sensitizes hepatocellular carcinoma cells to doxorubicin-induced apoptosis via targeting Mcl-1.
26636651 2015 Metastasis-associated MCL1 and P16 copy number alterations dictate resistance to vemurafenib in a BRAFV600E patient-derived papillary thyroid carcinoma preclinical model.
More...