Property Summary

NCBI Gene PubMed Count 811
Grant Count 4
Funding $130,495.78
PubMed Score 198.81
PubTator Score 4544.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
cutaneous lupus erythematosus 1.100 0.007
psoriasis -1.400 0.000
glioblastoma multiforme 1.400 0.000
osteosarcoma -1.272 0.001
medulloblastoma, large-cell -1.200 0.000
adrenocortical carcinoma 1.546 0.000
tuberculosis 1.100 0.000
group 3 medulloblastoma 1.600 0.017
spina bifida 1.050 0.035
gastric carcinoma 1.500 0.028

Gene

BAX

PANTHER Protein Class (1)

PDB

4BD2   4ZIG   4ZII   2K7W   4ZIE   4ZIF   4ZIH   3PK1   3PL7   1F16   2G5B   2LR1   4BD6   4BD7   4BD8   4BDU   4S0O   4S0P   4UF2  

Gene RIF (752)

PMID Text
26783364 Together, these super-resolution data provide direct evidence in support of large Bax-delineated pores in the mitochondrial outer membrane as being crucial for Bax-mediated mitochondrial outer membrane permeabilization in cells.
26783362 These data identify the supramolecular organization of Bax during apoptosis and support a molecular mechanism in which Bax fully or partially delineates pores of different sizes to permeabilize the mitochondrial outer membrane.
26782527 Transvaginal sonography can potentiate the apoptosis of human chorionic villus cells by increasing the Bax/Bcl2 protein ratio.
26763134 Data suggest that regulation of Bax stability and transport between cytosol and mitochondria is more tightly regulated by Bcl-xL/BCL2L1 when Bax has been phosphorylated at Ser184 by AKT1; experiments involved expression in haploid yeast strains.
26707131 The potent antitumor activity of RHL may be mediated through downregulation of Bcl-2 and cyclin D expression and upregulation of BAX and Bim expression.
26656462 the BCL2-938C>A and BAX-248G>A SNPs significantly associated with platinum-based chemotherapy response, PFS and OS of patients with advanced NSCLC.
26612919 Thus, this study demonstrated effective chemotherapeutic potential of SFE by inducing apoptisis as well as inhibiting migration and their preliminary mechanism for human gastric cancer management.
26565002 the recently proposed new therapies employing bcl-2 inhibitors prompted the potential use of bax/bcl-2 ratio to identify patients putatively resistant to these molecules.
26491047 Increasing the Bcl-2/Bax ratio by exposure to high extracellular ATP may, therefore, be an important selective pressure promoting transformation and cancer progression.
26458963 Dysadherin-silenced side population cells exhibited reduced expression of Bcl-2 and Bax compared with that prior to silencing.
More...

AA Sequence

MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDEL      1 - 70
DSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWT     71 - 140
LDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG                      141 - 192
//

Text Mined References (821)

PMID Year Title
26783364 2016 Bax assembles into large ring-like structures remodeling the mitochondrial outer membrane in apoptosis.
26783362 2016 Bax assembly into rings and arcs in apoptotic mitochondria is linked to membrane pores.
26782527 2015 Effect of transvaginal ultrasound on human chorionic villus cell apoptosis during pregnancy.
26763134 2016 Regulation of Bax/mitochondria interaction by AKT.
26707131 2016 Antitumor activity of rhein lysinate against human glioma U87 cells in vitro and in vivo.
26656462 2015 Polymorphisms of BCL2 and BAX Genes Associate with Outcomes in Advanced Non-small cell lung cancer Patients treated with platinum-based Chemotherapy.
26612919 2016 Sulforaphene promotes Bax/Bcl2, MAPK-dependent human gastric cancer AGS cells apoptosis and inhibits migration via EGFR, p-ERK1/2 down-regulation.
26565002 2016 Clinical significance of bax/bcl-2 ratio in chronic lymphocytic leukemia.
26491047 2016 ATP promotes cell survival via regulation of cytosolic [Ca2+] and Bcl-2/Bax ratio in lung cancer cells.
26458963 2015 Aberrantly regulated dysadherin and B-cell lymphoma 2/B-cell lymphoma 2-associated X enhances tumorigenesis and DNA targeting drug resistance of liver cancer stem cells.
More...