Property Summary

NCBI Gene PubMed Count 59
PubMed Score 56.05
PubTator Score 62.52

Knowledge Summary

Patent (1,549)

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Generalized epilepsy with febrile seizures plus 7 0.0 5.0
Disease Target Count Z-score Confidence
Epilepsy 792 5.743 2.9
Familial atrial fibrillation 23 0.0 4.0

Expression

Protein-protein Interaction (10)

Gene RIF (42)

AA Sequence

MGRLLALVVGAALVSSACGGCVEVDSETEAVYGMTFKILCISCKRRSETNAETFTEWTFRQKGTEEFVKI      1 - 70
LRYENEVLQLEEDERFEGRVVWNGSRGTKDLQDLSIFITNVTYNHSGDYECHVYRLLFFENYEHNTSVVK     71 - 140
KIHIEVVDKANRDMASIVSEIMMYVLIVVLTIWLVAEMIYCYKKIAAATETAAQENASEYLAITSESKEN    141 - 210
CTGVQVAE                                                                  211 - 218
//

Text Mined References (63)

PMID Year Title