Property Summary

NCBI Gene PubMed Count 150
PubMed Score 158.15
PubTator Score 237.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
acute quadriplegic myopathy 1.242 3.4e-07
astrocytoma 1.300 7.6e-03
atypical teratoid/rhabdoid tumor 1.100 2.2e-05
breast carcinoma 1.200 4.5e-03
diabetes mellitus -1.600 2.1e-03
group 3 medulloblastoma 1.200 6.4e-03
lung adenocarcinoma 1.115 6.7e-07
lung cancer 1.100 2.3e-02
medulloblastoma, large-cell 1.300 2.6e-05
Multiple myeloma 1.031 1.3e-04
osteosarcoma 1.268 4.3e-05
ovarian cancer 1.800 2.6e-04
pancreatic ductal adenocarcinoma liver m... 1.003 1.8e-02
primitive neuroectodermal tumor 1.100 6.0e-05
psoriasis -1.600 6.3e-04

Protein-protein Interaction (1)

Gene RIF (89)

AA Sequence

MQRRDDPAARMSRSSGRSGSMDPSGAHPSVRQTPSRQPPLPHRSRGGGGGSRGGARASPATQPPPLLPPS      1 - 70
ATGPDATVGGPAPTPLLPPSATASVKMEPENKYLPELMAEKDSLDPSFTHAMQLLTAEIEKIQKGDSKKD     71 - 140
DEENYLDLFSHKNMKLKERVLIPVKQYPKFNFVGKILGPQGNTIKRLQEETGAKISVLGKGSMRDKAKEE    141 - 210
ELRKGGDPKYAHLNMDLHVFIEVFGPPCEAYALMAHAMEEVKKFLVPDMMDDICQEQFLELSYLNGVPEP    211 - 280
SRGRGVPVRGRGAAPPPPPVPRGRGVGPPRGALVRGTPVRGAITRGATVTRGVPPPPTVRGAPAPRARTA    281 - 350
GIQRIPLPPPPAPETYEEYGYDDTYAEQSYEGYEGYYSQSQGDSEYYDYGHGEVQDSYEAYGQDDWNGTR    351 - 420
PSLKAPPARPVKGAYREHPYGRY                                                   421 - 443
//

Text Mined References (170)

PMID Year Title