Property Summary

NCBI Gene PubMed Count 139
Grant Count 147
R01 Count 101
Funding $13,117,726.45
PubMed Score 150.94
PubTator Score 237.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Multiple myeloma 1.031 0.000
psoriasis -1.600 0.001
osteosarcoma 1.268 0.000
group 4 medulloblastoma 1.400 0.000
astrocytoma 1.300 0.008
medulloblastoma, large-cell 1.300 0.000
primitive neuroectodermal tumor 1.200 0.000
acute quadriplegic myopathy 1.247 0.000
pancreatic ductal adenocarcinoma liver m... 1.003 0.018
lung cancer 1.100 0.023
breast carcinoma 1.200 0.004
diabetes mellitus -1.800 0.003
atypical teratoid/rhabdoid tumor 1.100 0.000
lung adenocarcinoma 1.115 0.000
ovarian cancer 1.800 0.000

Synonym

Accession Q07666 D3DPP3 Q6PJX7 Q8NB97 Q99760
Symbols p62
p68
Sam68

Gene

PDB

3QHE   2XA6  

Gene RIF (95)

PMID Text
26758068 Sam68 and T-STAR could regulate alternative splicing of some pre-mRNAs by bringing two distant UAA motifs into proximity and looping out regions of the pre-mRNA.
26695943 The host factor Sam68 interact with both, foot-and-mouth disease virus RNA motifs in the internal ribosome binding site and viral non-structural proteins 3C(pro) and 3D(pol).
26438629 The RNA-binding protein Sam68 regulates tumor cell viability and hepatic carcinogenesis by inhibiting the transcriptional activity of FOXOs
26350037 Sam68 Promotes NF-kappaB Activation and Apoptosis Signaling in Articular Chondrocytes during Osteoarthritis
26310125 Sam68 has separable effects on the regulation of AR-V7 expression and transcriptional activity, through its RNA-binding capacity.
26273626 Here we review recent studies on the role of SAM68 in splicing regulation and we discuss its contribution to aberrant pre-mRNA processing in cancer. [review]
26202240 The nuclear protein Sam68 is found as an additional new host factor that interacts with the enterovirus 71 IRES during infection and could potentially enhance the translation of virus protein.
26136151 MicroRNA-203 inhibits the malignant progression of neuroblastoma by targeting Sam68.
26080397 results reveal the complex molecular mechanism underlying SMAR1-mediated signal-dependent and -independent regulation of alternative splicing via Sam68 deacetylation
26050229 Sam68 could promote esophageal squamous cell carcinoma(ESCC) cell proliferation via the activation of Akt/GSK-3beta pathway. This research indicated that Sam68 might accelerate the cell cycle progression and be considered as a new therapy target in ESCC
More...

AA Sequence

MQRRDDPAARMSRSSGRSGSMDPSGAHPSVRQTPSRQPPLPHRSRGGGGGSRGGARASPATQPPPLLPPS      1 - 70
ATGPDATVGGPAPTPLLPPSATASVKMEPENKYLPELMAEKDSLDPSFTHAMQLLTAEIEKIQKGDSKKD     71 - 140
DEENYLDLFSHKNMKLKERVLIPVKQYPKFNFVGKILGPQGNTIKRLQEETGAKISVLGKGSMRDKAKEE    141 - 210
ELRKGGDPKYAHLNMDLHVFIEVFGPPCEAYALMAHAMEEVKKFLVPDMMDDICQEQFLELSYLNGVPEP    211 - 280
SRGRGVPVRGRGAAPPPPPVPRGRGVGPPRGALVRGTPVRGAITRGATVTRGVPPPPTVRGAPAPRARTA    281 - 350
GIQRIPLPPPPAPETYEEYGYDDTYAEQSYEGYEGYYSQSQGDSEYYDYGHGEVQDSYEAYGQDDWNGTR    351 - 420
PSLKAPPARPVKGAYREHPYGRY                                                   421 - 443
//

Text Mined References (158)

PMID Year Title
26758068 2016 Structural basis of RNA recognition and dimerization by the STAR proteins T-STAR and Sam68.
26695943 2015 Analysis of the interaction between host factor Sam68 and viral elements during foot-and-mouth disease virus infections.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26438629 2015 The RNA-binding protein Sam68 regulates tumor cell viability and hepatic carcinogenesis by inhibiting the transcriptional activity of FOXOs.
26350037 2015 Sam68 Promotes NF-?B Activation and Apoptosis Signaling in Articular Chondrocytes during Osteoarthritis.
26310125 2015 The RNA-binding protein Sam68 regulates expression and transcription function of the androgen receptor splice variant AR-V7.
26273626 2015 SAM68: Signal Transduction and RNA Metabolism in Human Cancer.
26202240 2015 Nuclear Protein Sam68 Interacts with the Enterovirus 71 Internal Ribosome Entry Site and Positively Regulates Viral Protein Translation.
26136151 2015 MicroRNA-203 inhibits the malignant progression of neuroblastoma by targeting Sam68.
26080397 2015 Nuclear matrix-associated protein SMAR1 regulates alternative splicing via HDAC6-mediated deacetylation of Sam68.
More...