Property Summary

NCBI Gene PubMed Count 125
PubMed Score 621.63
PubTator Score 311.49

Knowledge Summary

Patent

No data available

Gene RIF (103)

AA Sequence

MAARALCMLGLVLALLSSSSAEEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCF      1 - 70
KPLQEAECTF                                                                 71 - 80
//

Text Mined References (129)

PMID Year Title