Property Summary

NCBI Gene PubMed Count 117
Grant Count 131
R01 Count 83
Funding $15,644,621.66
PubMed Score 588.51
PubTator Score 311.49

Knowledge Summary

Patent

No data available

Synonym

Accession Q07654 E9PBB5 Q96NX0 Q9UDA5
Symbols ITF
P1B
TFI

Gene

PANTHER Protein Class (2)

PDB

1E9T   1PE3  

Gene RIF (95)

PMID Text
26823779 TFF3 protein knockout can facilitate apoptosis of human pituitary adenoma HP75 cells via mitochondrial pathway
26780310 Dimers CXCR4 and CXCR7 are involved in TFF3-dependent activation of cell migration, but not cell proliferation. The ERK1/2 pathway is activated in the process, but not influenced by CXCR4 or CXCR7.
26559818 Data show that trefoil factor-3 (TFF3) secreted from mammary carcinoma cells promotes de novo angiogenesis via interleukin-8 (IL-8)/IL-8 receptor CXCR2.
26240479 These findings suggest that the rs184432 and rs225359 polymorphisms in TFF1 have protective effects for GC and contribute to the development of GC in Korean individuals.
25900183 TFF3 expression is associated with response to endocrine therapy, and outperforms oestrogen receptor, progesterone receptor and TFF1 as an independent biomarker, possibly because it mediates the malign effects of oestrogen on invasion and metastasis
25776570 the results provide a mechanistic explanation for ITF-mediated protection of gastric epithelial mucosa cells, suggesting that activation of the ERK1/2 signaling pathway may provide a new therapeutic strategy for repairing gastric injury.
25748388 High TFF3 expression is associated with reduces sensitivity to ionising radiation in prostate carcinoma.
25639219 ERG and TFF3 expression characterize 2 distinct subsets of prostate cancer, with a more aggressive subgroup of TFF3-expressing tumors that express SPINK1.
25634542 primary outcome measures were to evaluate the safety, acceptability, and accuracy of the Cytosponge-TFF3 test compared with endoscopy and biopsy. In all, 1,042 (93.9%) patients successfully swallowed the Cytosponge, and there were no serious side effects
25514872 This study suggests that TFF3 is an independent indicator for survival in GC, while HER2 is not associated with the outcome. Patients with HER2-negative/TFF3-negative GC have the best outcome.
More...

AA Sequence

MAARALCMLGLVLALLSSSSAEEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCF      1 - 70
KPLQEAECTF                                                                 71 - 80
//

Text Mined References (121)

PMID Year Title
26823779 2015 TFF3 knockout in human pituitary adenoma cell HP75 facilitates cell apoptosis via mitochondrial pathway.
26780310 2016 CXCR4 and CXCR7 Mediate TFF3-Induced Cell Migration Independently From the ERK1/2 Signaling Pathway.
26559818 2015 Trefoil Factor-3 (TFF3) Stimulates De Novo Angiogenesis in Mammary Carcinoma both Directly and Indirectly via IL-8/CXCR2.
26240479 2015 Association between Promoter Polymorphisms of TFF1, TFF2, and TFF3 and the Risk of Gastric and Diffuse Gastric Cancers in a Korean Population.
25900183 2015 TFF3 is a valuable predictive biomarker of endocrine response in metastatic breast cancer.
25776570 2015 Protective effects of intestinal trefoil factor (ITF) on gastric mucosal epithelium through activation of extracellular signal-regulated kinase 1/2 (ERK1/2).
25748388 2015 Trefoil factor 3 (TFF3) enhances the oncogenic characteristics of prostate carcinoma cells and reduces sensitivity to ionising radiation.
25639219 2015 Clinical value of ERG, TFF3, and SPINK1 for molecular subtyping of prostate cancer.
25634542 2015 Evaluation of a minimally invasive cell sampling device coupled with assessment of trefoil factor 3 expression for diagnosing Barrett's esophagus: a multi-center case-control study.
25514872 2015 TFF3 and HER2 expression and their correlation with survival in gastric cancer.
More...