Property Summary

NCBI Gene PubMed Count 6
PubMed Score 160.35
PubTator Score 3.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
malignant mesothelioma 3232 4.5e-05
diabetes mellitus 1728 1.1e-03
psoriasis 6694 4.5e-03
Atopic dermatitis 952 1.3e-02
Disease Target Count Z-score Confidence
Periostitis 5 3.535 1.8

Gene RIF (2)

AA Sequence

MACCQTSFCGFPSCSTSGTCGSSCCQPSCCETSSCQPRCCETSCCQPSCCQTSFCGFPSFSTGGTCDSSC      1 - 70
CQPSCCETSCCQPSCYQTSSCGTGCGIGGGIGYGQEGSSGAVSTRIRWCRPDCRVEGTCLPPCCVVSCTP     71 - 140
PSCCQLHHAEASCCRPSYCGQSCCRPVCCCYCSEPTC                                     141 - 177
//

Text Mined References (7)

PMID Year Title