Property Summary

NCBI Gene PubMed Count 6
Grant Count 11
R01 Count 3
Funding $524,644.99
PubMed Score 149.88
PubTator Score 3.45

Knowledge Summary

Patent

No data available

Gene RIF (2)

PMID Text
24439038 Krtap11-1 may play an important role on keratin-bundle assembly in the hair cortex.
12228244 polymorphisms in Japanese and Caucasian individuals

AA Sequence

MACCQTSFCGFPSCSTSGTCGSSCCQPSCCETSSCQPRCCETSCCQPSCCQTSFCGFPSFSTGGTCDSSC      1 - 70
CQPSCCETSCCQPSCYQTSSCGTGCGIGGGIGYGQEGSSGAVSTRIRWCRPDCRVEGTCLPPCCVVSCTP     71 - 140
PSCCQLHHAEASCCRPSYCGQSCCRPVCCCYCSEPTC                                     141 - 177
//

Text Mined References (7)

PMID Year Title
24439038 2014 Krtap11-1, a hair keratin-associated protein, as a possible crucial element for the physical properties of hair shafts.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12228244 2002 Polymorphisms in the human high sulfur hair keratin-associated protein 1, KAP1, gene family.
11841537 2002 hKAP1.6 and hKAP1.7, two novel human high sulfur keratin-associated proteins are expressed in the hair follicle cortex.
11279113 2001 Characterization of a cluster of human high/ultrahigh sulfur keratin-associated protein genes embedded in the type I keratin gene domain on chromosome 17q12-21.