Property Summary

NCBI Gene PubMed Count 16
Grant Count 9
R01 Count 6
Funding $1,902,706.11
PubMed Score 92.46
PubTator Score 18.94

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q07617 A6NP70 B3KQ58 G3XAM3 Q7Z5G1
Symbols SP75
TPIS
CT140
CILD28
HSD-3.8
HEL-S-268

Gene

PANTHER Protein Class (1)

Gene RIF (4)

PMID Text
24055112 SPAG1 probably plays a role in the cytoplasmic assembly.
16983343 Immunocytochemical analysis demonstrated colocalization of SPAG1 with microtubules, and their association was confirmed by co-immunoprecipitation; subsequent motility assays further substantiated a potential role of SPAG1 in cancer cell motility
16368546 HSD-3.8 (SPAG1), interacts with G-protein beta 1 subunit and activates extracellular signal-regulated kinases 1 and 2
12846798 The h-Sp-1 molecule is expressed in sperm and testes and plays a role in fertilization.

AA Sequence

MTTKDYPSLWGFGTTKTFKIPIEHLDFKYIEKCSDVKHLEKILCVLRSGEEGYYPELTEFCEKHLQALAP      1 - 70
ESRALRKDKPAATAASFTAEEWEKIDGDIKSWVSEIKKEEDKMHFHETETFPAMKDNLPPVRGSNSCLHV     71 - 140
GKEKYSKRPTKKKTPRDYAEWDKFDVEKECLKIDEDYKEKTVIDKSHLSKIETRIDTAGLTEKEKDFLAT    141 - 210
REKEKGNEAFNSGDYEEAVMYYTRSISALPTVVAYNNRAQAEIKLQNWNSAFQDCEKVLELEPGNVKALL    211 - 280
RRATTYKHQNKLREATEDLSKVLDVEPDNDLAKKTLSEVERDLKNSEAASETQTKGKRMVIQEIENSEDE    281 - 350
EGKSGRKHEDGGGDKKPAEPAGAARAAQPCVMGNIQKKLTGKAEGGKRPARGAPQRGQTPEAGADKRSPR    351 - 420
RASAAAAAGGGATGHPGGGQGAENPAGLKSQGNELFRSGQFAEAAGKYSAAIALLEPAGSEIADDLSILY    421 - 490
SNRAACYLKEGNCSGCIQDCNRALELHPFSMKPLLRRAMAYETLEQYGKAYVDYKTVLQIDCGLQLANDS    491 - 560
VNRLSRILMELDGPNWREKLSPIPAVPASVPLQAWHPAKEMISKQAGDSSSHRQQGITDEKTFKALKEEG    561 - 630
NQCVNDKNYKDALSKYSECLKINNKECAIYTNRALCYLKLCQFEEAKQDCDQALQLADGNVKAFYRRALA    631 - 700
HKGLKNYQKSLIDLNKVILLDPSIIEAKMELEEVTRLLNLKDKTAPFNKEKERRKIEIQEVNEGKEEPGR    701 - 770
PAGEVSMGCLASEKGGKSSRSPEDPEKLPIAKPNNAYEFGQIINALSTRKDKEACAHLLAITAPKDLPMF    771 - 840
LSNKLEGDTFLLLIQSLKNNLIEKDPSLVYQHLLYLSKAERFKMMLTLISKGQKELIEQLFEDLSDTPNN    841 - 910
HFTLEDIQALKRQYEL                                                          911 - 926
//

Text Mined References (18)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24055112 2013 Mutations in SPAG1 cause primary ciliary dyskinesia associated with defective outer and inner dynein arms.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16983343 2007 Sperm-associated antigen 1 is expressed early in pancreatic tumorigenesis and promotes motility of cancer cells.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16368546 2006 A sperm component, HSD-3.8 (SPAG1), interacts with G-protein beta 1 subunit and activates extracellular signal-regulated kinases (ERK).
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12846798 2003 Isolation and characterization of a human sperm antigen gene h-Sp-1.
More...