Property Summary

NCBI Gene PubMed Count 5
PubMed Score 10.29
PubTator Score 15.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
diabetes mellitus 1,663

Gene RIF (2)

PMID Text
24435510 Results show that the human epididymal BSPH1 shares many biochemical and functional characteristics with BSP proteins secreted by seminal vesicles of ungulates, and behaves similarly to its murine epididymal orthologue BSPH1.
19091820 BSPH1 accumulates in inclusion bodies when expressed with an N-terminal hexahistidine tag in BL21 (DE3) Escherichia coli cells, and recombinant protein bound phosphatidylcholine liposomes, low-density lipoproteins and human sperm.

AA Sequence

MGSLMLLFVETTRNSSACIFPVILNELSSTVETITHFPEVTDGECVFPFHYKNGTYYDCIKSKARHKWCS      1 - 70
LNKTYEGYWKFCSAEDFANCVFPFWYRRLIYWECTDDGEAFGKKWCSLTKNFNKDRIWKYCE             71 - 132
//

Text Mined References (5)

PMID Year Title
24435510 2014 Implication of the human Binder of SPerm Homolog 1 (BSPH1) protein in capacitation.
19091820 2009 Recombinant expression and affinity purification of a novel epididymal human sperm-binding protein, BSPH1.
18923155 2009 New nomenclature for mammalian BSP genes.
17085770 2007 Genomic structure and tissue-specific expression of human and mouse genes encoding homologues of the major bovine seminal plasma proteins.
15057824 2004 The DNA sequence and biology of human chromosome 19.