Property Summary

NCBI Gene PubMed Count 5
PubMed Score 10.29
PubTator Score 15.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
diabetes mellitus 1728 1.0e-03

Gene RIF (2)

AA Sequence

MGSLMLLFVETTRNSSACIFPVILNELSSTVETITHFPEVTDGECVFPFHYKNGTYYDCIKSKARHKWCS      1 - 70
LNKTYEGYWKFCSAEDFANCVFPFWYRRLIYWECTDDGEAFGKKWCSLTKNFNKDRIWKYCE             71 - 132
//

Text Mined References (5)

PMID Year Title