Property Summary

NCBI Gene PubMed Count 24
PubMed Score 1232.91
PubTator Score 32.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Varicosity 4
Disease Target Count P-value
lung carcinoma 2844 1.80964678023264E-20
lung adenocarcinoma 2714 1.55584667839882E-10
intraductal papillary-mucinous carcinoma (IPMC) 2988 2.27879377593531E-8
Duchenne muscular dystrophy 602 2.36765575816247E-8
intraductal papillary-mucinous adenoma (IPMA) 2956 1.00997579759084E-6
non-small cell lung cancer 2798 1.05928154696502E-6
lung cancer 4473 1.44688200950361E-6
adrenocortical carcinoma 1427 3.80756730229058E-6
colon cancer 1475 5.12488322712928E-6
intraductal papillary-mucinous neoplasm (IPMN) 3289 9.93715148475405E-6
breast carcinoma 1614 1.94298144912507E-5
psoriasis 6685 8.32061454597259E-5
pancreatic cancer 2300 2.40124365781787E-4
limb girdle muscular dystrophy 2A 156 2.52338200487941E-4
invasive ductal carcinoma 2950 3.47063461187412E-4
ductal carcinoma in situ 1745 5.63457172618297E-4
interstitial cystitis 2299 0.00114558760809711
Becker muscular dystrophy 187 0.00148999590675866
Atopic dermatitis 944 0.0019289457334162
ovarian cancer 8492 0.00201282606508414
fibroadenoma 557 0.00259981255508519
non-inflammatory breast cancer 208 0.00434874126792949
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00935352184765185
non primary Sjogren syndrome sicca 840 0.0113307809992084
aldosterone-producing adenoma 664 0.0177741278045442
adrenocortical adenoma 134 0.0202231241566552
Disease Target Count Z-score Confidence
Heart conduction disease 65 0.0 2.0

Expression

Synonym

Accession Q07507 A8K981 Q8N4R2 Q9UIX8
Symbols TRAMP

Gene

DPT

PANTHER Protein Class (1)

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (12)

PMID Text
25509878 The obtained results indicate that the changes in gene expression in bone marrow progenitor cells can be involved into space flight-induced osteopenia.
25304290 Lumican, decorin and dermatopontin are differentially expressed and may serve as biomarkers for metastatic and recurrent Giant cell tumor of bone
25260909 This study essentially deals with assessing the expression and integrity of an extracellular matrix protein, Dermatopontin (DPT), in chronic cutaneous wounds.
25082449 dermatopontin functional peptide produces fibrinogen fibrils and modifies its biological activity
23877568 These results indicate that DPT can modify certain biological functions of fibrin, and thus a another function of this extracellular matrix protein was revealed.
21796630 data provided strong evidence that downregulation of DPT is a characteristic event in human oral squamous cell carcinoma and that DPT was correlated with cellular adhesion and invasiveness.
21398523 DPT has an accelerating role in fibroblast cell adhesion to the provisional matrix in the initial stage of wound healing.
19916908 suggests that dermatopontin can play various roles in different tissues and might be a molecule related to carcinogenesis and the progression of HCC via possible interaction with TGF-beta1 and other potential mechanisms
19536175 Observational study of gene-disease association. (HuGE Navigator)
19064610 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MDLSLLWVLLPLVTMAWGQYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCPQGQVIVAVRSIFSKKEGSD      1 - 70
RQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQTCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCP     71 - 140
YSCWLTTEYPGHYGEEMDMISYNYDYYIRGATTTFSAVERDRQWKFIMCRMTEYDCEFANV             141 - 201
//

Text Mined References (26)

PMID Year Title
25509878 [The effects of simulated microgravity on the pattern of gene expression in human bone marrow mesenchymal stem cells under osteogenic differentiation].
25304290 2014 Gene expression profiling of giant cell tumor of bone reveals downregulation of extracellular matrix components decorin and lumican associated with lung metastasis.
25260909 2014 Expression and integrity of dermatopontin in chronic cutaneous wounds: a crucial factor in impaired wound healing.
25082449 2014 Functional peptide of dermatopontin produces fibrinogen fibrils and modifies its biological activity.
24952745 2014 Genetic association study of QT interval highlights role for calcium signaling pathways in myocardial repolarization.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23877568 2014 Dermatopontin regulates fibrin formation and its biological activity.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22261194 2012 Proteomics analysis of cardiac extracellular matrix remodeling in a porcine model of ischemia/reperfusion injury.
21796630 2012 Dermatopontin: a potential predictor for metastasis of human oral cancer.
More...