Property Summary

NCBI Gene PubMed Count 24
Grant Count 278
R01 Count 30
Funding $65,532,265.38
PubMed Score 1232.91
PubTator Score 32.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (54)

Disease Z-score Confidence
Diphtheria 23 7.695 3.8
Pertussis 17 7.469 3.7
Measles 20 7.096 3.5
Tetanus 66 6.928 3.5
Poliomyelitis 11 6.429 3.2
Astigmatism 27 6.173 3.1
Anisometropia 16 5.426 2.7
Myopia 99 5.292 2.6
Cycloplegia 13 5.11 2.6
Hyperopia 33 4.747 2.4
Mumps 10 4.734 2.4
Rubella 14 4.421 2.2
Japanese encephalitis 6 4.259 2.1
Hepatitis B 103 3.955 2.0
Amblyopia 24 3.873 1.9
Aniseikonia 3 3.744 1.9
Chickenpox 6 3.737 1.9
Keratoconus 47 3.631 1.8
Smallpox 20 3.588 1.8
Cataract 104 3.435 1.7
Preretinal fibrosis 4 3.4 1.7
Yellow fever 14 3.387 1.7
tuberculosis 1,557 3.288 1.6
Congenital ptosis 5 3.238 1.6
Typhoid fever 22 3.208 1.6
Allergic hypersensitivity disease 123 3.157 1.6
Atopic dermatitis 944
Becker muscular dystrophy 187
Duchenne muscular dystrophy 602
Heart conduction disease 65 2.0
Varicosity 4
adrenocortical adenoma 134
adrenocortical carcinoma 1,427
aldosterone-producing adenoma 664
autosomal dominant Emery-Dreifuss muscul... 499 
breast carcinoma 1,614
colon cancer 1,475
ductal carcinoma in situ 1,745
fibroadenoma 557
interstitial cystitis 2,299
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
limb girdle muscular dystrophy 2A 156
lung adenocarcinoma 2,713
lung cancer 4,466
lung carcinoma 2,844
non primary Sjogren syndrome sicca 840
non-inflammatory breast cancer 208
non-small cell lung cancer 2,798
ovarian cancer 8,484
pancreatic cancer 2,300
psoriasis 6,685

Expression

Synonym

Accession Q07507 A8K981 Q8N4R2 Q9UIX8
Symbols TRAMP

Gene

DPT

PANTHER Protein Class (1)

Gene RIF (12)

PMID Text
25509878 The obtained results indicate that the changes in gene expression in bone marrow progenitor cells can be involved into space flight-induced osteopenia.
25304290 Lumican, decorin and dermatopontin are differentially expressed and may serve as biomarkers for metastatic and recurrent Giant cell tumor of bone
25260909 This study essentially deals with assessing the expression and integrity of an extracellular matrix protein, Dermatopontin (DPT), in chronic cutaneous wounds.
25082449 dermatopontin functional peptide produces fibrinogen fibrils and modifies its biological activity
23877568 These results indicate that DPT can modify certain biological functions of fibrin, and thus a another function of this extracellular matrix protein was revealed.
21796630 data provided strong evidence that downregulation of DPT is a characteristic event in human oral squamous cell carcinoma and that DPT was correlated with cellular adhesion and invasiveness.
21398523 DPT has an accelerating role in fibroblast cell adhesion to the provisional matrix in the initial stage of wound healing.
19916908 suggests that dermatopontin can play various roles in different tissues and might be a molecule related to carcinogenesis and the progression of HCC via possible interaction with TGF-beta1 and other potential mechanisms
19536175 Observational study of gene-disease association. (HuGE Navigator)
19064610 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MDLSLLWVLLPLVTMAWGQYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCPQGQVIVAVRSIFSKKEGSD      1 - 70
RQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQTCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCP     71 - 140
YSCWLTTEYPGHYGEEMDMISYNYDYYIRGATTTFSAVERDRQWKFIMCRMTEYDCEFANV             141 - 201
//

Text Mined References (26)

PMID Year Title
25509878 [The effects of simulated microgravity on the pattern of gene expression in human bone marrow mesenchymal stem cells under osteogenic differentiation].
25304290 2014 Gene expression profiling of giant cell tumor of bone reveals downregulation of extracellular matrix components decorin and lumican associated with lung metastasis.
25260909 2014 Expression and integrity of dermatopontin in chronic cutaneous wounds: a crucial factor in impaired wound healing.
25082449 2014 Functional peptide of dermatopontin produces fibrinogen fibrils and modifies its biological activity.
24952745 2014 Genetic association study of QT interval highlights role for calcium signaling pathways in myocardial repolarization.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23877568 2014 Dermatopontin regulates fibrin formation and its biological activity.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22261194 2012 Proteomics analysis of cardiac extracellular matrix remodeling in a porcine model of ischemia/reperfusion injury.
21796630 2012 Dermatopontin: a potential predictor for metastasis of human oral cancer.
More...