Property Summary

NCBI Gene PubMed Count 27
PubMed Score 1302.13
PubTator Score 32.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Varicose veins 20 0.0 0.0
Disease Target Count
Varicosity 12
Disease Target Count Z-score Confidence
Heart conduction disease 83 0.0 2.3

Expression

  Differential Expression (26)

Disease log2 FC p
adrenocortical adenoma -1.782 2.0e-02
adrenocortical carcinoma -1.114 1.3e-05
aldosterone-producing adenoma -1.559 1.8e-02
Atopic dermatitis -1.300 1.9e-03
autosomal dominant Emery-Dreifuss muscul... 1.513 9.4e-03
Becker muscular dystrophy 1.438 1.5e-03
breast carcinoma -2.900 1.9e-05
colon cancer -1.400 3.0e-02
Duchenne muscular dystrophy 1.500 3.6e-07
ductal carcinoma in situ -1.800 8.1e-03
fibroadenoma -2.800 2.6e-03
interstitial cystitis -1.700 2.6e-02
intraductal papillary-mucinous adenoma (... -2.700 1.6e-05
intraductal papillary-mucinous carcinoma... -2.900 1.0e-05
intraductal papillary-mucinous neoplasm ... -3.000 4.7e-04
invasive ductal carcinoma -1.409 2.3e-02
limb girdle muscular dystrophy 2A 1.270 6.0e-04
lung adenocarcinoma -1.500 1.1e-09
lung cancer -2.100 7.2e-04
lung carcinoma -2.900 1.8e-20
non primary Sjogren syndrome sicca 1.100 1.1e-02
non-inflammatory breast cancer -2.100 4.3e-03
non-small cell lung cancer -1.362 1.1e-06
ovarian cancer -1.300 2.0e-03
pancreatic cancer -1.400 7.8e-05
psoriasis -1.300 2.3e-04

Gene RIF (13)

AA Sequence

MDLSLLWVLLPLVTMAWGQYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCPQGQVIVAVRSIFSKKEGSD      1 - 70
RQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQTCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCP     71 - 140
YSCWLTTEYPGHYGEEMDMISYNYDYYIRGATTTFSAVERDRQWKFIMCRMTEYDCEFANV             141 - 201
//

Text Mined References (29)

PMID Year Title