Property Summary

NCBI Gene PubMed Count 43
PubMed Score 38.65
PubTator Score 27.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
acute quadriplegic myopathy 1.866 7.4e-05
adult high grade glioma 1.300 4.7e-02
aldosterone-producing adenoma -1.512 3.2e-02
Alzheimer's disease 1.500 1.6e-02
Amyotrophic lateral sclerosis 1.389 6.6e-05
astrocytic glioma 1.800 2.8e-02
Astrocytoma, Pilocytic 1.700 1.9e-03
atypical teratoid / rhabdoid tumor 3.200 5.9e-09
autosomal dominant Emery-Dreifuss muscul... 2.133 1.1e-03
cystic fibrosis 1.323 1.7e-04
Down syndrome 1.400 7.0e-03
Duchenne muscular dystrophy 1.612 1.1e-05
ependymoma 2.400 3.5e-02
fascioscapulohumeral muscular dystrophy 1.254 1.6e-03
gastric carcinoma 1.300 4.0e-02
glioblastoma 1.600 1.6e-03
group 3 medulloblastoma -1.600 5.8e-04
juvenile dermatomyositis 1.703 3.5e-11
lung cancer -1.300 1.8e-04
lung carcinoma -1.900 5.3e-26
medulloblastoma, large-cell -2.000 2.2e-02
oligodendroglioma 1.400 4.4e-02
osteosarcoma 1.210 2.6e-02
ovarian cancer -1.700 1.5e-06
pancreatic ductal adenocarcinoma liver m... 1.135 3.0e-02
Pick disease 1.500 3.8e-03
pituitary cancer -2.200 2.4e-07
primitive neuroectodermal tumor 1.500 7.3e-03
psoriasis -3.600 4.0e-06
ulcerative colitis 1.400 8.0e-04

Gene RIF (13)

AA Sequence

MTTTLVSATIFDLSEVLCKGNKMLNYSAPSAGGCLLDRKAVGTPAGGGFPRRHSVTLPSSKFHQNQLLSS      1 - 70
LKGEPAPALSSRDSRFRDRSFSEGGERLLPTQKQPGGGQVNSSRYKTELCRPFEENGACKYGDKCQFAHG     71 - 140
IHELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNAEERRALAGARDLSADRPRLQHSFSFAGFPSA    141 - 210
AATAAATGLLDSPTSITPPPILSADDLLGSPTLPDGTNNPFAFSSQELASLFAPSMGLPGGGSPTTFLFR    211 - 280
PMSESPHMFDSPPSPQDSLSDQEGYLSSSSSSHSGSDSPTLDNSRRLPIFSRLSISDD                281 - 338
//

Text Mined References (50)

PMID Year Title