Property Summary

NCBI Gene PubMed Count 43
Grant Count 29
R01 Count 10
Funding $6,144,458.84
PubMed Score 36.31
PubTator Score 27.61

Knowledge Summary

Patent

No data available

Expression

Gene RIF (13)

PMID Text
26542173 A ZFP36L1-mediated regulatory circuit through repressing CDK6 expression.
25670004 Gene expression analysis revealed that three gene BACH2, PTGER4 and ZFP36L1, are down-regulated in MS patients' blood cells compared to healthy subjects.
25014217 ZFP36L1 interacts with and mediates degradation of anti-apoptotic BCL2 mRNA as its important target in malignant B-cells.
24700863 regulator of renal mineralocorticoid receptor abundance
24086717 NR4A2 expression is negatively regulated by zinc finger protein 36, C3H1 type-like 1 (Zfp36l1).
21278925 The roles of TTP and BRF proteins in regulated mRNA decay.
20702587 ZFP36L1 negatively regulates erythroid differentiation by directly binding the 3' untranslated region of Stat5b encoding mRNA.
20166898 these results suggest an important role of ZFP36L1 in wound healing.
19801654 Von Hippel-Lindau gene product modulates TIS11B expression in renal cell carcinoma and has a role in vascular endothelial growth factor expression in hypoxia
19417105 crystal structures of human and S. pombe eRF1 in complex with eRF3 lacking the GTPase domain revealed details of the interaction between these two factors and marked conformational changes in eRF1 that occur upon binding to eRF3
More...

AA Sequence

MTTTLVSATIFDLSEVLCKGNKMLNYSAPSAGGCLLDRKAVGTPAGGGFPRRHSVTLPSSKFHQNQLLSS      1 - 70
LKGEPAPALSSRDSRFRDRSFSEGGERLLPTQKQPGGGQVNSSRYKTELCRPFEENGACKYGDKCQFAHG     71 - 140
IHELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNAEERRALAGARDLSADRPRLQHSFSFAGFPSA    141 - 210
AATAAATGLLDSPTSITPPPILSADDLLGSPTLPDGTNNPFAFSSQELASLFAPSMGLPGGGSPTTFLFR    211 - 280
PMSESPHMFDSPPSPQDSLSDQEGYLSSSSSSHSGSDSPTLDNSRRLPIFSRLSISDD                281 - 338
//

Text Mined References (50)

PMID Year Title
27182009 2016 Functional analysis of ZFP36 proteins in keratinocytes.
26542173 2015 ZFP36L1 promotes monocyte/macrophage differentiation by repressing CDK6.
25670004 2015 Anti-inflammatory genes associated with multiple sclerosis: a gene expression study.
25106868 2014 ZFP36L1 and ZFP36L2 control LDLR mRNA stability via the ERK-RSK pathway.
25014217 2014 Post-transcriptional regulation of BCL2 mRNA by the RNA-binding protein ZFP36L1 in malignant B cells.
24700863 2014 Hypertonicity compromises renal mineralocorticoid receptor signaling through Tis11b-mediated post-transcriptional control.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24086717 2013 NR4A2 is regulated by gastrin and influences cellular responses of gastric adenocarcinoma cells.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...