Property Summary

NCBI Gene PubMed Count 80
PubMed Score 124.49
PubTator Score 119.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
ulcerative colitis 2087 7.59067595912721E-8
malignant mesothelioma 3163 6.68124855793283E-7
sonic hedgehog group medulloblastoma 1482 1.52705002674403E-6
psoriasis 6685 4.07743027672764E-6
lung cancer 4473 4.5312481740434E-6
Breast cancer 3099 1.14951690846854E-5
pilocytic astrocytoma 3086 1.77066516082721E-5
medulloblastoma, large-cell 6234 2.33853018138901E-5
cystic fibrosis 1670 3.21584099837941E-5
posterior fossa group B ependymoma 1530 6.61841036961304E-5
lung adenocarcinoma 2714 1.11605026037725E-4
ovarian cancer 8492 1.34461373530517E-4
atypical teratoid/rhabdoid tumor 1095 2.96050452683023E-4
tuberculosis 1563 4.34153158477886E-4
interstitial cystitis 2299 5.42762214253244E-4
Down syndrome 548 0.00217351075476191
head and neck cancer and chronic obstructive pulmonary disease 237 0.00338473003909069
osteosarcoma 7933 0.00536353358789707
dermatomyositis 967 0.0108026459307386
pituitary cancer 1972 0.011364586691333
acute quadriplegic myopathy 1157 0.0132147140663772
Gaucher disease type 3 76 0.0172928009320007
Waldenstrons macroglobulinemia 765 0.0193975471228824
aldosterone-producing adenoma 664 0.0195698376882595
invasive ductal carcinoma 2950 0.0261723101649468
oligodendroglioma 2849 0.0265627019047809
active Crohn's disease 918 0.0308517782474673
glioblastoma 5572 0.0349354182263601
chronic rhinosinusitis 512 0.0351001022794128
gastric carcinoma 832 0.0463510115296861
head and neck cancer 270 0.0476016019235893
subependymal giant cell astrocytoma 2287 0.0491229170960702
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 192 0.0 1.0
Disease Target Count Z-score Confidence
Acrodysostosis 9 3.653 1.8
Chronic obstructive pulmonary disease 147 3.442 1.7

Expression

  Differential Expression (33)

Synonym

Accession Q07343 A5YW33 O15443 Q13945 Q5TEK4 Q5TEK5 Q5TEK6
Symbols DPDE4
PDEIVB

Gene

PANTHER Protein Class (2)

PDB

2CHM   3HC8   3HDZ   1F0J   1JP1   1JP2   1RO6   1RO9   1ROR   1TB5   1XLX   1XLZ   1XM4   1XM6   1XMU   1XMY   1XN0   1XOS   1XOT   1Y2H   1Y2J   2QYL   3D3P   3FRG   3G45   3GWT   3HMV   3KKT   3LY2   3O0J   3O56   3O57   3W5E   3WD9   4KP6   4MYQ   4NW7   4WZI   4X0F  

  Ortholog (4)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG
Rat OMA EggNOG

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
607 confirmatory 38 / 1666 / 7498 qHTS Assay for Inhibitors of PDE-IV

Gene RIF (50)

PMID Text
26756575 This meta-analysis suggests that PDE4B SNPs are genetically associated with susceptibility to schizophrenia.
26011935 Our results suggest that PDE4B does not play an important role during the chemotactic response of human neutrophils
25926551 Our results support previously reported association of PDE4B variations with schizophrenia in other populations.
25831493 analysis of the mechanism underlying synergistic up-regulation of PDE4B2 via a cross-talk between PKA-Cbeta and p65
24732776 Cyclic AMP phosphodiesterase inhibitors AV411 and AV1013 inhibit HIV-1 replication and block HIV-1 Tat-induced neurotoxicity in human microglia, suggesting that cyclic AMP phosphodiesterase is involved in the Tat-mediated neurotoxicity
23575688 ototopical post-inoculation administration of a PDE4 inhibitor suppresses inflammation in this animal model, thus demonstrating the therapeutic potential of targeting PDE4
23451206 PDE4B was found to be highly expressed in CD4+ lymphoid cancer cells, which suggests that it may represent a physiological role unique to the CD8+ and lymphoid cancer cells and thus might represent a target for treatment of certain lymphoid diseases
22832604 Short Disrupted-in-Schizophrenia (DISC)1 splice variants show reduced or no binding to nudE nuclear distribution E homolog (NDEL)1 and PDE4B proteins but fully interact with fasciculation/elongation zeta (FEZ)1 and glycogen synthase kinase 3 GSK3beta.
22610099 PDE4B mediates ERK-dependent up-regulation of mucin MUC5AC by S. pneumoniae by inhibiting cAMP-PKA-dependent MKP-1 pathway.
22529021 PDE4B was downregulated and the protein kinase A pathway was activated in castration-resistant LNCaP prostate cancer cells. PDE4B expression was reduced in advanced prostate cancer and PDE4B knockdown promoted castration-resistant growth of LNCaP cells.
More...

AA Sequence

MKKSRSVMTVMADDNVKDYFECSLSKSYSSSSNTLGIDLWRGRRCCSGNLQLPPLSQRQSERARTPEGDG      1 - 70
ISRPTTLPLTTLPSIAITTVSQECFDVENGPSPGRSPLDPQASSSAGLVLHATFPGHSQRRESFLYRSDS     71 - 140
DYDLSPKAMSRNSSLPSEQHGDDLIVTPFAQVLASLRSVRNNFTILTNLHGTSNKRSPAASQPPVSRVNP    141 - 210
QEESYQKLAMETLEELDWCLDQLETIQTYRSVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEYISNTFL    211 - 280
DKQNDVEIPSPTQKDREKKKKQQLMTQISGVKKLMHSSSLNNTSISRFGVNTENEDHLAKELEDLNKWGL    281 - 350
NIFNVAGYSHNRPLTCIMYAIFQERDLLKTFRISSDTFITYMMTLEDHYHSDVAYHNSLHAADVAQSTHV    351 - 420
LLSTPALDAVFTDLEILAAIFAAAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHHLAVGFKLLQEE    421 - 490
HCDIFMNLTKKQRQTLRKMVIDMVLATDMSKHMSLLADLKTMVETKKVTSSGVLLLDNYTDRIQVLRNMV    491 - 560
HCADLSNPTKSLELYRQWTDRIMEEFFQQGDKERERGMEISPMCDKHTASVEKSQVGFIDYIVHPLWETW    561 - 630
ADLVQPDAQDILDTLEDNRNWYQSMIPQSPSPPLDEQNRDCQGLMEKFQFELTLDEEDSEGPEKEGEGHS    631 - 700
YFSSTKTLCVIDPENRDSLGETDIDIATEDKSPVDT                                      701 - 736
//

Text Mined References (83)

PMID Year Title
26756575 2016 Association of PDE4B Polymorphisms with Susceptibility to Schizophrenia: A Meta-Analysis of Case-Control Studies.
26011935 2015 The role of phosphodiesterase 4B in IL-8/LTB4-induced human neutrophil chemotaxis evaluated with a phosphodiesterase 4B inhibitor.
25926551 2015 Association analysis of PDE4B polymorphisms with schizophrenia and smooth pursuit eye movement abnormality in a Korean population.
25831493 2015 Cross-talk between PKA-C? and p65 mediates synergistic induction of PDE4B by roflumilast and NTHi.
24847357 2014 Genome wide association study of SNP-, gene-, and pathway-based approaches to identify genes influencing susceptibility to Staphylococcus aureus infections.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
23575688 2013 Inhibition of PDE4B suppresses inflammation by increasing expression of the deubiquitinase CYLD.
23451206 2013 Genome wide mapping reveals PDE4B as an IL-2 induced STAT5 target gene in activated human PBMCs and lymphoid cancer cells.
23007406 2012 Genome-wide association study identifies germline polymorphisms associated with relapse of childhood acute lymphoblastic leukemia.
22832604 2011 Interactions of human truncated DISC1 proteins: implications for schizophrenia.
More...