Property Summary

NCBI Gene PubMed Count 80
Grant Count 89
R01 Count 52
Funding $7,706,633.49
PubMed Score 124.49
PubTator Score 119.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (65)

Disease Z-score Confidence
Schizophrenia 501 4.696 2.3
Bipolar Disorder 266 3.754 1.9
Acrodysostosis 9 3.653 1.8
Chronic obstructive pulmonary disease 146 3.442 1.7
Asthma 349 3.278 1.6
Alcoholic Intoxication, Chronic 41
Amphetamine-Related Disorders 74
Aphthous ulcer of mouth 7
Arsenic Poisoning 59
Asthma management 20
Asthma night-time symptoms 7
Asthma-chronic obstructive pulmonary dis... 7 
Atopic dermatitis 944
Autistic Disorder 320
Breast cancer 3,094
Bronchospasm 9
COPD Associated with Chronic Bronchitis 11
Carcinoma 2,147 1.0
Chronic bronchitis 4
Dermatologic disorders 65
Down syndrome 548
Dysuria 24
Gaucher disease type 3 76
Increased Urinary Frequency 11
Leukemia, Myelocytic, Acute 113
Myocardial Ischemia 169
Nocturia 8
Peripheral vascular disease 90
Pulmonary emphysema 34
Severe chronic obstructive pulmonary dis... 4 
Staphylococcus aureus infection 1
Suprapubic pain 8
Type 2 diabetes mellitus 189 1.0
Urgent desire to urinate 11
Urinary Tract Irritation 24
Urinary incontinence 13
Waldenstrons macroglobulinemia 765
active Crohn's disease 918
acute quadriplegic myopathy 1,157
aldosterone-producing adenoma 664
atypical teratoid/rhabdoid tumor 1,095
chronic rhinosinusitis 512
cystic fibrosis 1,665
dermatomyositis 933
gastric carcinoma 832
glioblastoma 5,572
head and neck cancer 270
head and neck cancer and chronic obstruc... 237 
interstitial cystitis 2,299
invasive ductal carcinoma 2,950
lung adenocarcinoma 2,713
lung cancer 4,466
malignant mesothelioma 3,162
medulloblastoma, large-cell 6,234
oligodendroglioma 2,849
osteosarcoma 7,933
ovarian cancer 8,484
pilocytic astrocytoma 3,086
pituitary cancer 1,972
posterior fossa group B ependymoma 1,530
psoriasis 6,685
sonic hedgehog group medulloblastoma 1,482
subependymal giant cell astrocytoma 2,287
tuberculosis 1,557
ulcerative colitis 2,087

Expression

  Differential Expression (33)

Synonym

Accession Q07343 A5YW33 O15443 Q13945 Q5TEK4 Q5TEK5 Q5TEK6
Symbols DPDE4
PDEIVB

Gene

PANTHER Protein Class (2)

PDB

2CHM   3HC8   3HDZ   1F0J   1JP1   1JP2   1RO6   1RO9   1ROR   1TB5   1XLX   1XLZ   1XM4   1XM6   1XMU   1XMY   1XN0   1XOS   1XOT   1Y2H   1Y2J   2QYL   3D3P   3FRG   3G45   3GWT   3HMV   3KKT   3LY2   3O0J   3O56   3O57   3W5E   3WD9   4KP6   4MYQ   4NW7   4WZI   4X0F  

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
607 confirmatory 38 / 1666 / 7498 qHTS Assay for Inhibitors of PDE-IV

Gene RIF (50)

PMID Text
26756575 This meta-analysis suggests that PDE4B SNPs are genetically associated with susceptibility to schizophrenia.
26011935 Our results suggest that PDE4B does not play an important role during the chemotactic response of human neutrophils
25926551 Our results support previously reported association of PDE4B variations with schizophrenia in other populations.
25831493 analysis of the mechanism underlying synergistic up-regulation of PDE4B2 via a cross-talk between PKA-Cbeta and p65
24732776 Cyclic AMP phosphodiesterase inhibitors AV411 and AV1013 inhibit HIV-1 replication and block HIV-1 Tat-induced neurotoxicity in human microglia, suggesting that cyclic AMP phosphodiesterase is involved in the Tat-mediated neurotoxicity
23575688 ototopical post-inoculation administration of a PDE4 inhibitor suppresses inflammation in this animal model, thus demonstrating the therapeutic potential of targeting PDE4
23451206 PDE4B was found to be highly expressed in CD4+ lymphoid cancer cells, which suggests that it may represent a physiological role unique to the CD8+ and lymphoid cancer cells and thus might represent a target for treatment of certain lymphoid diseases
22832604 Short Disrupted-in-Schizophrenia (DISC)1 splice variants show reduced or no binding to nudE nuclear distribution E homolog (NDEL)1 and PDE4B proteins but fully interact with fasciculation/elongation zeta (FEZ)1 and glycogen synthase kinase 3 GSK3beta.
22610099 PDE4B mediates ERK-dependent up-regulation of mucin MUC5AC by S. pneumoniae by inhibiting cAMP-PKA-dependent MKP-1 pathway.
22529021 PDE4B was downregulated and the protein kinase A pathway was activated in castration-resistant LNCaP prostate cancer cells. PDE4B expression was reduced in advanced prostate cancer and PDE4B knockdown promoted castration-resistant growth of LNCaP cells.
More...

AA Sequence

MKKSRSVMTVMADDNVKDYFECSLSKSYSSSSNTLGIDLWRGRRCCSGNLQLPPLSQRQSERARTPEGDG      1 - 70
ISRPTTLPLTTLPSIAITTVSQECFDVENGPSPGRSPLDPQASSSAGLVLHATFPGHSQRRESFLYRSDS     71 - 140
DYDLSPKAMSRNSSLPSEQHGDDLIVTPFAQVLASLRSVRNNFTILTNLHGTSNKRSPAASQPPVSRVNP    141 - 210
QEESYQKLAMETLEELDWCLDQLETIQTYRSVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEYISNTFL    211 - 280
DKQNDVEIPSPTQKDREKKKKQQLMTQISGVKKLMHSSSLNNTSISRFGVNTENEDHLAKELEDLNKWGL    281 - 350
NIFNVAGYSHNRPLTCIMYAIFQERDLLKTFRISSDTFITYMMTLEDHYHSDVAYHNSLHAADVAQSTHV    351 - 420
LLSTPALDAVFTDLEILAAIFAAAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHHLAVGFKLLQEE    421 - 490
HCDIFMNLTKKQRQTLRKMVIDMVLATDMSKHMSLLADLKTMVETKKVTSSGVLLLDNYTDRIQVLRNMV    491 - 560
HCADLSNPTKSLELYRQWTDRIMEEFFQQGDKERERGMEISPMCDKHTASVEKSQVGFIDYIVHPLWETW    561 - 630
ADLVQPDAQDILDTLEDNRNWYQSMIPQSPSPPLDEQNRDCQGLMEKFQFELTLDEEDSEGPEKEGEGHS    631 - 700
YFSSTKTLCVIDPENRDSLGETDIDIATEDKSPVDT                                      701 - 736
//

Text Mined References (83)

PMID Year Title
26756575 2016 Association of PDE4B Polymorphisms with Susceptibility to Schizophrenia: A Meta-Analysis of Case-Control Studies.
26011935 2015 The role of phosphodiesterase 4B in IL-8/LTB4-induced human neutrophil chemotaxis evaluated with a phosphodiesterase 4B inhibitor.
25926551 2015 Association analysis of PDE4B polymorphisms with schizophrenia and smooth pursuit eye movement abnormality in a Korean population.
25831493 2015 Cross-talk between PKA-C? and p65 mediates synergistic induction of PDE4B by roflumilast and NTHi.
24847357 2014 Genome wide association study of SNP-, gene-, and pathway-based approaches to identify genes influencing susceptibility to Staphylococcus aureus infections.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
23575688 2013 Inhibition of PDE4B suppresses inflammation by increasing expression of the deubiquitinase CYLD.
23451206 2013 Genome wide mapping reveals PDE4B as an IL-2 induced STAT5 target gene in activated human PBMCs and lymphoid cancer cells.
23007406 2012 Genome-wide association study identifies germline polymorphisms associated with relapse of childhood acute lymphoblastic leukemia.
22832604 2011 Interactions of human truncated DISC1 proteins: implications for schizophrenia.
More...