Property Summary

Ligand Count 814
NCBI Gene PubMed Count 83
PubMed Score 124.33
PubTator Score 119.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Disease Target Count Z-score Confidence
Acrodysostosis 12 3.581 1.8
Chronic obstructive pulmonary disease 184 3.433 1.7

Expression

  Differential Expression (33)

Disease log2 FC p
Bipolar Disorder 2.418 2.2e-02
active Crohn's disease 1.387 3.1e-02
acute quadriplegic myopathy 1.232 1.3e-02
aldosterone-producing adenoma -1.077 2.0e-02
Astrocytoma, Pilocytic 1.500 8.8e-07
atypical teratoid / rhabdoid tumor -1.700 1.4e-02
Breast cancer -2.200 1.1e-05
chronic rhinosinusitis 1.006 3.5e-02
cystic fibrosis 2.093 3.2e-05
dermatomyositis 1.400 1.1e-02
Down syndrome 1.300 2.2e-03
gastric cancer -1.100 2.6e-02
Gaucher disease type 3 -1.500 3.6e-02
glioblastoma 1.400 3.5e-02
group 3 medulloblastoma -1.200 4.1e-02
head and neck cancer 1.200 4.8e-02
head and neck cancer and chronic obstruc... 1.300 3.4e-03
interstitial cystitis 2.500 5.4e-04
invasive ductal carcinoma 1.800 2.6e-02
lung adenocarcinoma -1.411 1.1e-04
lung cancer -2.200 4.9e-04
malignant mesothelioma -2.800 6.7e-07
medulloblastoma, large-cell -2.000 2.3e-05
oligodendroglioma 1.400 2.7e-02
osteosarcoma 1.890 5.4e-03
ovarian cancer -1.500 1.0e-04
pituitary cancer 1.800 1.1e-02
posterior fossa group B ependymoma -1.100 6.6e-05
psoriasis -1.400 4.1e-06
subependymal giant cell astrocytoma -1.424 4.9e-02
tuberculosis -1.700 9.2e-05
ulcerative colitis 4.000 7.6e-08
Waldenstrons macroglobulinemia 1.116 1.9e-02

PDB (40)

Gene RIF (53)

AA Sequence

MKKSRSVMTVMADDNVKDYFECSLSKSYSSSSNTLGIDLWRGRRCCSGNLQLPPLSQRQSERARTPEGDG      1 - 70
ISRPTTLPLTTLPSIAITTVSQECFDVENGPSPGRSPLDPQASSSAGLVLHATFPGHSQRRESFLYRSDS     71 - 140
DYDLSPKAMSRNSSLPSEQHGDDLIVTPFAQVLASLRSVRNNFTILTNLHGTSNKRSPAASQPPVSRVNP    141 - 210
QEESYQKLAMETLEELDWCLDQLETIQTYRSVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEYISNTFL    211 - 280
DKQNDVEIPSPTQKDREKKKKQQLMTQISGVKKLMHSSSLNNTSISRFGVNTENEDHLAKELEDLNKWGL    281 - 350
NIFNVAGYSHNRPLTCIMYAIFQERDLLKTFRISSDTFITYMMTLEDHYHSDVAYHNSLHAADVAQSTHV    351 - 420
LLSTPALDAVFTDLEILAAIFAAAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHHLAVGFKLLQEE    421 - 490
HCDIFMNLTKKQRQTLRKMVIDMVLATDMSKHMSLLADLKTMVETKKVTSSGVLLLDNYTDRIQVLRNMV    491 - 560
HCADLSNPTKSLELYRQWTDRIMEEFFQQGDKERERGMEISPMCDKHTASVEKSQVGFIDYIVHPLWETW    561 - 630
ADLVQPDAQDILDTLEDNRNWYQSMIPQSPSPPLDEQNRDCQGLMEKFQFELTLDEEDSEGPEKEGEGHS    631 - 700
YFSSTKTLCVIDPENRDSLGETDIDIATEDKSPVDT                                      701 - 736
//

Text Mined References (86)

PMID Year Title