Property Summary

Ligand Count 805
NCBI Gene PubMed Count 83
PubMed Score 124.33
PubTator Score 119.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Disease Target Count Z-score Confidence
Acrodysostosis 12 3.581 1.8
Chronic obstructive pulmonary disease 184 3.433 1.7

Expression

  Differential Expression (33)

Disease log2 FC p
Bipolar Disorder 2.418 2.2e-02
active Crohn's disease 1.387 3.1e-02
acute quadriplegic myopathy 1.232 1.3e-02
aldosterone-producing adenoma -1.077 2.0e-02
Astrocytoma, Pilocytic 1.500 8.8e-07
atypical teratoid / rhabdoid tumor -1.700 1.4e-02
Breast cancer -2.200 1.1e-05
chronic rhinosinusitis 1.006 3.5e-02
cystic fibrosis 2.093 3.2e-05
dermatomyositis 1.400 1.1e-02
Down syndrome 1.300 2.2e-03
gastric cancer -1.100 2.6e-02
Gaucher disease type 3 -1.500 3.6e-02
glioblastoma 1.400 3.5e-02
group 3 medulloblastoma -1.200 4.1e-02
head and neck cancer 1.200 4.8e-02
head and neck cancer and chronic obstruc... 1.300 3.4e-03
interstitial cystitis 2.500 5.4e-04
invasive ductal carcinoma 1.800 2.6e-02
lung adenocarcinoma -1.411 1.1e-04
lung cancer -2.200 4.9e-04
malignant mesothelioma -2.800 6.7e-07
medulloblastoma, large-cell -2.000 2.3e-05
oligodendroglioma 1.400 2.7e-02
osteosarcoma 1.890 5.4e-03
ovarian cancer -1.500 1.0e-04
pituitary cancer 1.800 1.1e-02
posterior fossa group B ependymoma -1.100 6.6e-05
psoriasis -1.400 4.1e-06
subependymal giant cell astrocytoma -1.424 4.9e-02
tuberculosis -1.700 9.2e-05
ulcerative colitis 4.000 7.6e-08
Waldenstrons macroglobulinemia 1.116 1.9e-02

Synonym

Accession Q07343 A5YW33 O15443 Q13945 Q5TEK4 Q5TEK5 Q5TEK6
Symbols DPDE4
PDEIVB

Gene

PDB

2CHM   3HC8   3HDZ   1F0J   1JP1   1JP2   1RO6   1RO9   1ROR   1TB5   1XLX   1XLZ   1XM4   1XM6   1XMU   1XMY   1XN0   1XOS   1XOT   1Y2H   1Y2J   2QYL   3D3P   3FRG   3G45   3GWT   3HMV   3KKT   3LY2   3O0J   3O56   3O57   3W5E   3WD9   4KP6   4MYQ   4NW7   4WZI   4X0F   5K6J  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (53)

AA Sequence

MKKSRSVMTVMADDNVKDYFECSLSKSYSSSSNTLGIDLWRGRRCCSGNLQLPPLSQRQSERARTPEGDG      1 - 70
ISRPTTLPLTTLPSIAITTVSQECFDVENGPSPGRSPLDPQASSSAGLVLHATFPGHSQRRESFLYRSDS     71 - 140
DYDLSPKAMSRNSSLPSEQHGDDLIVTPFAQVLASLRSVRNNFTILTNLHGTSNKRSPAASQPPVSRVNP    141 - 210
QEESYQKLAMETLEELDWCLDQLETIQTYRSVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEYISNTFL    211 - 280
DKQNDVEIPSPTQKDREKKKKQQLMTQISGVKKLMHSSSLNNTSISRFGVNTENEDHLAKELEDLNKWGL    281 - 350
NIFNVAGYSHNRPLTCIMYAIFQERDLLKTFRISSDTFITYMMTLEDHYHSDVAYHNSLHAADVAQSTHV    351 - 420
LLSTPALDAVFTDLEILAAIFAAAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHHLAVGFKLLQEE    421 - 490
HCDIFMNLTKKQRQTLRKMVIDMVLATDMSKHMSLLADLKTMVETKKVTSSGVLLLDNYTDRIQVLRNMV    491 - 560
HCADLSNPTKSLELYRQWTDRIMEEFFQQGDKERERGMEISPMCDKHTASVEKSQVGFIDYIVHPLWETW    561 - 630
ADLVQPDAQDILDTLEDNRNWYQSMIPQSPSPPLDEQNRDCQGLMEKFQFELTLDEEDSEGPEKEGEGHS    631 - 700
YFSSTKTLCVIDPENRDSLGETDIDIATEDKSPVDT                                      701 - 736
//

Text Mined References (86)

PMID Year Title