Property Summary

NCBI Gene PubMed Count 33
Grant Count 64
R01 Count 47
Funding $3,738,406.44
PubMed Score 66.22
PubTator Score 53.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma -1.100 0.000
psoriasis -1.200 0.003
tuberculosis 1.500 0.000
lung cancer 1.100 0.007
interstitial cystitis -1.100 0.000
group 3 medulloblastoma 1.400 0.001
acute myeloid leukemia -1.200 0.020
ovarian cancer -1.600 0.000

Synonym

Accession Q07326 Q8WW20 PIG-F
Symbols

Gene

PANTHER Protein Class (2)

Gene RIF (26)

PMID Text
26434493 There is a significant negative correlation between the concentration of sFLt-1 and PlGF in normal pregnancy.
25450457 Glioma cell-released PlGF can induce Bregs to suppress CD8(+) T cell activities.
25388629 Data showed that sFlt-1/PlGF ratio increases with volume overload and persistent hypoxia after surgery with CHD.
25354293 VEGF/PlGF levels were higher in neonates exposed to pre-eclampsia, and there was a significant negative correlation between birth weight and VEGF/PlGF levels.
25128974 In chronic kidney patients not yet on dialysis, higher serum level of PIGF are associated with increased mortality, but not cardiovascular events.
25074286 A highly conserved motif in PIGF is not involved in binding to PIGO or PIGG, but critical for its function.
24921169 PIGF gene is upregulated in patients diagnosed with retinal reactive astrocytic tumors.
24595913 In high-risk patients the sFlt1/PlGF ratio can be used for an individual risk assessment with regard to PE, HELLP syndrome or IUGR. Serial measurements permit a risk-adapted prenatal care of these patients
24166749 Soluble flt1 is increased in preeclampsia and is associated with decreased levels of bioactive PiGF.
23661335 IL-17A, IL-17B, IL-17F and IL-23 in systemic lupus erythematosus patients were examined and the correlation between levels of the investigated cytokines and VEGF, PIGF, as well as number of endothelial cells, was investigated.
More...

AA Sequence

MKDNDIKRLLYTHLLCIFSIILSVFIPSLFLENFSILETHLTWLCICSGFVTAVNLVLYLVVKPNTSSKR      1 - 70
SSLSHKVTGFLKCCIYFLMSCFSFHVIFVLYGAPLIELALETFLFAVILSTFTTVPCLCLLGPNLKAWLR     71 - 140
VFSRNGVTSIWENSLQITTISSFVGAWLGALPIPLDWERPWQVWPISCTLGATFGYVAGLVISPLWIYWN    141 - 210
RKQLTYKNN                                                                 211 - 219
//

Text Mined References (34)

PMID Year Title
26434493 2015 Difference of concentration of placental soluble fms-like tyrosine kinase-1(sFlt-1), placental growth factor (PlGF), and sFlt-1/PlGF ratio in severe preeclampsia and normal pregnancy.
25450457 2014 Glioma cell-derived placental growth factor induces regulatory B cells.
25388629 2015 Ratio between fms-like tyrosine kinase 1 and placental growth factor in children with congenital heart disease.
25354293 2015 Influence of maternal pre-eclampsia on VEGF/PlGF heterodimer levels in preterm infants.
25128974 2014 Association of vascular endothelial factors with cardiovascular outcome and mortality in chronic kidney disease patients: a 4-year cohort study.
25074286 2014 New insights into the functions of PIGF, a protein involved in the ethanolamine phosphate transfer steps of glycosylphosphatidylinositol biosynthesis.
24921169 2014 Retinal reactive astrocytic tumor: gene expression profiling.
24595913 2014 [Predictive value of the sFlt1/PlGF ratio for the diagnosis of preeclampsia in high-risk patients].
24166749 2014 Angiogenic factors in diagnosis, management, and research in preeclampsia.
23661335 2013 Correlations between concentrations of interleukin (IL)-17A, IL-17B and IL-17F, and endothelial cells and proangiogenic cytokines in systemic lupus erythematosus patients.
More...