Property Summary

NCBI Gene PubMed Count 37
PubMed Score 69.16
PubTator Score 53.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 1.6e-05
interstitial cystitis 2312 5.6e-05
malignant mesothelioma 3232 6.4e-05
tuberculosis 2010 3.1e-04
group 3 medulloblastoma 4104 6.1e-04
psoriasis 6694 2.7e-03
lung cancer 4740 6.6e-03
acute myeloid leukemia 783 2.0e-02
Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 2.2
Disease Target Count Z-score Confidence
Pre-Eclampsia 68 5.351 2.7

Expression

  Differential Expression (8)

Disease log2 FC p
acute myeloid leukemia -1.200 2.0e-02
group 3 medulloblastoma 1.400 6.1e-04
interstitial cystitis -1.100 5.6e-05
lung cancer 1.100 6.6e-03
malignant mesothelioma -1.100 6.4e-05
ovarian cancer -1.600 1.6e-05
psoriasis -1.200 2.7e-03
tuberculosis 1.500 3.1e-04

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (30)

AA Sequence

MKDNDIKRLLYTHLLCIFSIILSVFIPSLFLENFSILETHLTWLCICSGFVTAVNLVLYLVVKPNTSSKR      1 - 70
SSLSHKVTGFLKCCIYFLMSCFSFHVIFVLYGAPLIELALETFLFAVILSTFTTVPCLCLLGPNLKAWLR     71 - 140
VFSRNGVTSIWENSLQITTISSFVGAWLGALPIPLDWERPWQVWPISCTLGATFGYVAGLVISPLWIYWN    141 - 210
RKQLTYKNN                                                                 211 - 219
//

Text Mined References (38)

PMID Year Title