Property Summary

NCBI Gene PubMed Count 144
Grant Count 387
R01 Count 198
Funding $34,474,604.71
PubMed Score 860.56
PubTator Score 395.10

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q07325 Q503B4
Symbols CMK
MIG
Humig
SCYB9
crg-10

Gene

Gene RIF (119)

PMID Text
26898419 CXCL9 is a useful predictor of better clinical outcome in colorectal cancer patients.
26828996 The mRNA expression and serum levels of CXCL9 were both increased.
26564003 Data show that asymptomatic patients with unstable plaques exhibited higher levels of endothelial microparticles (EMPs), CXCL9 chemokine and stem cell growth factor; lymphocyte secreted C-type lectin (SCGF-beta) compared to those with stable plaques.
26506526 congruent with the concept that inflammation plays a key role in the pathogenesis of LV dysfunction, MIG, IP10 and I-TAC add diagnostic accuracy over and beyond NT-pro BNP.
26268659 This paper suggests a role for Epithelial to mesenchymal cell transition in the pathogenesis of idiopathic pulmonary fibrosis and provides a novel mechanism for the inhibitory effects of CXCL9 on TGF-beta1-induced Epithelial to mesenchymal cell transition.
25972108 This work confirms that OPN, CCL5 and CXCL9 plasma levels are higher in psoriasis patients and provides evidence that their higher levels are not a consequence of obesity.
25950774 Suggest that CD44 and CXCL9 may serve as predictive biomarkers to identify liver allograft recipients at risk for clinically significant acute graft rejection.
25890876 This inhibitory action of resveratrol was also observed for the cytokines-induced expression of chemokines CXCL9, CCL2 and CCL5.
25713416 These findings functionally integrate K17, hnRNP K, and gene expression along with RSK and CXCR3 signaling in a keratinocyte-autonomous axis and provide a potential basis for their implication in tumorigenesis
25702175 There were no significant differences in distribution of CXCL9 genotypes and alleles between rheumatoid arthritis patients and control group.
More...

AA Sequence

MKKSGVLFLLGIILLVLIGVQGTPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNG      1 - 70
VQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT                    71 - 125
//

Text Mined References (144)

PMID Year Title
26898419 2016 The chemokine CXCL9 expression is associated with better prognosis for colorectal carcinoma patients.
26828996 2016 CXCL9 expression and polyomavirus BK infectivity in renal transplant patients with nephropathy.
26564003 2015 Elevated levels of endothelial-derived microparticles, and serum CXCL9 and SCGF-? are associated with unstable asymptomatic carotid plaques.
26506526 2015 Left Ventricular Dysfunction and CXCR3 Ligands in Hypertension: From Animal Experiments to a Population-Based Pilot Study.
26268659 2015 CXCL9 Regulates TGF-?1-Induced Epithelial to Mesenchymal Transition in Human Alveolar Epithelial Cells.
25972108 2015 Osteopontin, CCL5 and CXCL9 are independently associated with psoriasis, regardless of the presence of obesity.
25950774 2015 CD44 and CXCL9 serum protein levels predict the risk of clinically significant allograft rejection after liver transplantation.
25890876 2015 Resveratrol attenuates CXCL11 expression induced by proinflammatory cytokines in retinal pigment epithelial cells.
25713416 2015 Regulation of C-X-C chemokine gene expression by keratin 17 and hnRNP K in skin tumor keratinocytes.
25702175 2015 CXCL9 and CXCL10 gene polymorphisms in patients with rheumatoid arthritis.
More...