Property Summary

NCBI Gene PubMed Count 181
Grant Count 388
R01 Count 231
Funding $34,195,973.12
PubMed Score 1243.88
PubTator Score 611.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
malignant mesothelioma -2.100 0.000
esophageal adenocarcinoma -1.700 0.023
psoriasis 1.100 0.001
osteosarcoma 2.205 0.000
ependymoma 1.400 0.000
atypical teratoid / rhabdoid tumor 1.100 0.001
glioblastoma 1.100 0.009
group 4 medulloblastoma 2.100 0.000
acute quadriplegic myopathy 1.167 0.000
intraductal papillary-mucinous neoplasm ... 1.300 0.011
lung cancer -1.600 0.040
lung adenocarcinoma -1.400 0.000
pilocytic astrocytoma 1.200 0.001
subependymal giant cell astrocytoma -1.008 0.029
spina bifida -2.481 0.036
mucosa-associated lymphoid tissue lympho... 1.492 0.032
ovarian cancer -2.300 0.000
Down syndrome 1.200 0.002
dermatomyositis 1.500 0.001

Synonym

Accession Q07157 B4E3K1 Q2NKP3 Q4ZGJ6
Symbols ZO-1

Gene

PANTHER Protein Class (2)

PDB

3TSZ   2KXS   3SHW   2H2B   2H2C   2H3M   2JWE   2KXR   2RCZ   3CYY   3LH5   3SHU   3TSV   3TSW   4OEO   4OEP   4Q2Q   4YYX  

Gene RIF (146)

PMID Text
26863122 OCLN and ZO1 levels appear to be early prognostic markers in patients suffering from sepsis.
26645068 These data provide the first evidence that beta-catenin and ZO-1 are direct targets of E7 of the oncogenic beta-human papillomavirus types 5 and 8.
26306999 The data suggest that ZO-1, along with CD38 and Zap-70, plays a role in cell cycle regulation in chronic B cell leukemia, and may be used as a prognostic marker in the disease monitoring.
26293574 HTT may inhibit breast tumor dissemination through maintenance of ZO1 at tight junctions.
26023235 Phosphorylation state of the tyrosine of claudin-1 and claudin-2 regulates interaction with ZO1.
25953589 Report TNF-alpha/Il6 mediated dysregulation of zonula occludens-1 properties in human brain microvascular endothelium.
25892136 upon specific knockdown of the accessory TJP, ZO-1, undifferentiated NSCs showed decreased levels of key stem cell markers
25753039 ZO-1 is a central regulator of VE-cadherin-dependent endothelial junctions that orchestrates the spatial actomyosin organization.
25683991 ZO-1 was internalized and shown to accumulate in the cytoplasm of human podocytes in an IL-13 dose-dependent manner.
25452107 miR-18a and RUNX1 could reversely regulate the permeability of blood-tumor barrier as well as the expressions and distributions of ZO-1, occludin and claudin-5.
More...

AA Sequence

MSARAAAAKSTAMEETAIWEQHTVTLHRAPGFGFGIAISGGRDNPHFQSGETSIVISDVLKGGPAEGQLQ      1 - 70
ENDRVAMVNGVSMDNVEHAFAVQQLRKSGKNAKITIRRKKKVQIPVSRPDPEPVSDNEEDSYDEEIHDPR     71 - 140
SGRSGVVNRRSEKIWPRDRSASRERSLSPRSDRRSVASSQPAKPTKVTLVKSRKNEEYGLRLASHIFVKE    141 - 210
ISQDSLAARDGNIQEGDVVLKINGTVTENMSLTDAKTLIERSKGKLKMVVQRDERATLLNVPDLSDSIHS    211 - 280
ANASERDDISEIQSLASDHSGRSHDRPPRRSRSRSPDQRSEPSDHSRHSPQQPSNGSLRSRDEERISKPG    281 - 350
AVSTPVKHADDHTPKTVEEVTVERNEKQTPSLPEPKPVYAQVGQPDVDLPVSPSDGVLPNSTHEDGILRP    351 - 420
SMKLVKFRKGDSVGLRLAGGNDVGIFVAGVLEDSPAAKEGLEEGDQILRVNNVDFTNIIREEAVLFLLDL    421 - 490
PKGEEVTILAQKKKDVYRRIVESDVGDSFYIRTHFEYEKESPYGLSFNKGEVFRVVDTLYNGKLGSWLAI    491 - 560
RIGKNHKEVERGIIPNKNRAEQLASVQYTLPKTAGGDRADFWRFRGLRSSKRNLRKSREDLSAQPVQTKF    561 - 630
PAYERVVLREAGFLRPVTIFGPIADVAREKLAREEPDIYQIAKSEPRDAGTDQRSSGIIRLHTIKQIIDQ    631 - 700
DKHALLDVTPNAVDRLNYAQWYPIVVFLNPDSKQGVKTMRMRLCPESRKSARKLYERSHKLRKNNHHLFT    701 - 770
TTINLNSMNDGWYGALKEAIQQQQNQLVWVSEGKADGATSDDLDLHDDRLSYLSAPGSEYSMYSTDSRHT    771 - 840
SDYEDTDTEGGAYTDQELDETLNDEVGTPPESAITRSSEPVREDSSGMHHENQTYPPYSPQAQPQPIHRI    841 - 910
DSPGFKPASQQKAEASSPVPYLSPETNPASSTSAVNHNVNLTNVRLEEPTPAPSTSYSPQADSLRTPSTE    911 - 980
AAHIMLRDQEPSLSSHVDPTKVYRKDPYPEEMMRQNHVLKQPAVSHPGHRPDKEPNLTYEPQLPYVEKQA    981 - 1050
SRDLEQPTYRYESSSYTDQFSRNYEHRLRYEDRVPMYEEQWSYYDDKQPYPSRPPFDNQHSQDLDSRQHP   1051 - 1120
EESSERGYFPRFEEPAPLSYDSRPRYEQAPRASALRHEEQPAPGYDTHGRLRPEAQPHPSAGPKPAESKQ   1121 - 1190
YFEQYSRSYEQVPPQGFTSRAGHFEPLHGAAAVPPLIPSSQHKPEALPSNTKPLPPPPTQTEEEEDPAMK   1191 - 1260
PQSVLTRVKMFENKRSASLETKKDVNDTGSFKPPEVASKPSGAPIIGPKPTSQNQFSEHDKTLYRIPEPQ   1261 - 1330
KPQLKPPEDIVRSNHYDPEEDEEYYRKQLSYFDRRSFENKPPAHIAASHLSEPAKPAHSQNQSNFSSYSS   1331 - 1400
KGKPPEADGVDRSFGEKRYEPIQATPPPPPLPSQYAQPSQPVTSASLHIHSKGAHGEGNSVSLDFQNSLV   1401 - 1470
SKPDPPPSQNKPATFRPPNREDTAQAAFYPQKSFPDKAPVNGTEQTQKTVTPAYNRFTPKPYTSSARPFE   1471 - 1540
RKFESPKFNHNLLPSETAHKPDLSSKTPTSPKTLVKSHSLAQPPEFDSGVETFSIHAEKPKYQINNISTV   1541 - 1610
PKAIPVSPSAVEEDEDEDGHTVVATARGIFNSNGGVLSSIETGVSIIIPQGAIPEGVEQEIYFKVCRDNS   1611 - 1680
ILPPLDKEKGETLLSPLVMCGPHGLKFLKPVELRLPHCDPKTWQNKCLPGDPNYLVGANCVSVLIDHF     1681 - 1748
//

Text Mined References (193)

PMID Year Title
26863122 2016 PROGNOSTIC VALUE OF PLASMA TIGHT-JUNCTION PROTEINS FOR SEPSIS IN EMERGENCY DEPARTMENT: AN OBSERVATIONAL STUDY.
26645068 2016 The levels of epithelial anchor proteins ?-catenin and zona occludens-1 are altered by E7 of human papillomaviruses 5 and 8.
26306999 2016 ZO-1 expression shows prognostic value in chronic B cell leukemia.
26293574 2015 Unraveling the Role of Huntingtin in Breast Cancer Metastasis.
26023235 2015 Structural Basis of a Key Factor Regulating the Affinity between the Zonula Occludens First PDZ Domain and Claudins.
25953589 2015 Cytokine-mediated dysregulation of zonula occludens-1 properties in human brain microvascular endothelium.
25892136 2015 Identification and dynamic regulation of tight junction protein expression in human neural stem cells.
25753039 2015 ZO-1 controls endothelial adherens junctions, cell-cell tension, angiogenesis, and barrier formation.
25683991 2015 Effects of interleukin-13 and montelukast on the expression of zonula occludens-1 in human podocytes.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
More...