Property Summary

NCBI Gene PubMed Count 20
PubMed Score 6.99
PubTator Score 2.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
active Crohn's disease 2.224 3.5e-03
active ulcerative colitis 1.641 1.1e-02
atypical teratoid / rhabdoid tumor -1.900 1.1e-04
Breast cancer -1.100 5.6e-06
glioblastoma -1.200 1.9e-02
group 4 medulloblastoma -1.600 3.5e-04
interstitial lung disease 1.400 3.4e-03
intraductal papillary-mucinous carcinoma... 2.800 1.5e-02
intraductal papillary-mucinous neoplasm ... 1.400 2.3e-02
medulloblastoma, large-cell -1.200 1.6e-02
osteosarcoma 1.704 2.3e-02
ovarian cancer -1.800 3.0e-04
pancreatic cancer 2.300 4.4e-04
pancreatic ductal adenocarcinoma liver m... 1.468 1.4e-02
Pick disease -1.300 7.6e-05
pituitary cancer -1.200 1.4e-03
progressive supranuclear palsy -1.100 1.2e-02
psoriasis -1.200 4.7e-07

 GO Function (1)

Gene RIF (11)

AA Sequence

MWVSWAPGLWLLGLWATFGHGANTGAQCPPSQQEGLKLEHSSSLPANVTGFNLIHRLSLMKTSAIKKIRN      1 - 70
PKGPLILRLGAAPVTQPTRRVFPRGLPEEFALVLTLLLKKHTHQKTWYLFQVTDANGYPQISLEVNSQER     71 - 140
SLELRAQGQDGDFVSCIFPVPQLFDLRWHKLMLSVAGRVASVHVDCSSASSQPLGPRRPMRPVGHVFLGL    141 - 210
DAEQGKPVSFDLQQVHIYCDPELVLEEGCCEILPAGCPPETSKARRDTQSNELIEINPQSEGKVYTRCFC    211 - 280
LEEPQNSEVDAQLTGRISQKAERGAKVHQETAADECPPCVHGARDSNVTLAPSGPKGGKGERGLPGPPGS    281 - 350
KGEKGARGNDCVRISPDAPLQCAEGPKGEKGESGALGPSGLPGSTGEKGQKGEKGDGGIKGVPGKPGRDG    351 - 420
RPGEICVIGPKGQKGDPGFVGPEGLAGEPGPPGLPGPPGIGLPGTPGDPGGPPGPKGDKGSSGIPGKEGP    421 - 490
GGKPGKPGVKGEKGDPCEVCPTLPEGFQNFVGLPGKPGPKGEPGDPVPARGDPGIQGIKGEKGEPCLSCS    491 - 560
SVVGAQHLVSSTGASGDVGSPGFGLPGLPGRAGVPGLKGEKGNFGEAGPAGSPGPPGPVGPAGIKGAKGE    561 - 630
PCEPCPALSNLQDGDVRVVALPGPSGEKGEPGPPGFGLPGKQGKAGERGLKGQKGDAGNPGDPGTPGTTG    631 - 700
RPGLSGEPGVQGPAGPKGEKGDGCTACPSLQGTVTDMAGRPGQPGPKGEQGPEGVGRPGKPGQPGLPGVQ    701 - 770
GPPGLKGVQGEPGPPGRGVQGPQGEPGAPGLPGIQGLPGPRGPPGPTGEKGAQGSPGVKGATGPVGPPGA    771 - 840
SVSGPPGRDGQQGQTGLRGTPGEKGPRGEKGEPGECSCPSQGDLIFSGMPGAPGLWMGSSWQPGPQGPPG    841 - 910
IPGPPGPPGVPGLQGVPGNNGLPGQPGLTAELGSLPIEQHLLKSICGDCVQGQRAHPGYLVEKGEKGDQG    911 - 980
IPGVPGLDNCAQCFLSLERPRAEEARGDNSEGDPGCVGSPGLPGPPGLPGQRGEEGPPGMRGSPGPPGPI    981 - 1050
GPPGFPGAVGSPGLPGLQGERGLTGLTGDKGEPGPPGQPGYPGATGPPGLPGIKGERGYTGSAGEKGEPG   1051 - 1120
PPGSEGLPGPPGPAGPRGERGPQGNSGEKGDQGFQGQPGFPGPPGPPGFPGKVGSPGPPGPQAEKGSEGI   1121 - 1190
RGPSGLPGSPGPPGPPGIQGPAGLDGLDGKDGKPGLRGDPGPAGPPGLMGPPGFKGKTGHPGLPGPKGDC   1191 - 1260
GKPGPPGSTGRPGAEGEPGAMGPQGRPGPPGHVGPPGPPGQPGPAGISAVGLKGDRGATGERGLAGLPGQ   1261 - 1330
PGPPGHPGPPGEPGTDGAAGKEGPPGKQGFYGPPGPKGDPGAAGQKGQAGEKGRAGMPGGPGKSGSMGPV   1331 - 1400
GPPGPAGERGHPGAPGPSGSPGLPGVPGSMGDMVNYDEIKRFIRQEIIKMFDERMAYYTSRMQFPMEMAA   1401 - 1470
APGRPGPPGKDGAPGRPGAPGSPGLPGQIGREGRQGLPGVRGLPGTKGEKGDIGIGIAGENGLPGPPGPQ   1471 - 1540
GPPGYGKMGATGPMGQQGIPGIPGPPGPMGQPGKAGHCNPSDCFGAMPMEQQYPPMKTMKGPFG         1541 - 1604
//

Text Mined References (21)

PMID Year Title