Property Summary

NCBI Gene PubMed Count 19
PubMed Score 6.90
PubTator Score 2.85

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q07092 Q16593 Q59F89 Q71RG9
Symbols 447AA
FP1572

Gene

 GO Function (1)

Gene RIF (11)

PMID Text
26424749 The NC11 domain of collagen XVI is a potential biomarker for oral squamous cell carcinoma and triggers vasculogenic mimicry via upregulation of endothelial receptors VEGFR1, VEGFR2 and uPAR.
24466237 High Collagen XVI expression is associated with invasion of oral squamous cell carcinoma.
23149016 collagen XVI plays a decisive role in the interaction of connective tissue cells with their ECM, which is impaired in pathological situations
22716248 Gene expression profiles showed that COL16A1 was up-regulated in epidermolysis bullosa subtypes.
21251976 Overexpression of type XVI collagen in aberrant oral keratinocytes leads to Kindlin-1 induction, increased Kindlin-1/beta1-integrin interaction, integrin activation and subsequently to a proliferative cellular phenotype.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19931388 Collagen XVI promotes persistence of intestinal subepithelial myofibroblasts in the normal and in the inflamed bowel wall by stabilizing focal adhesion contacts.
19913121 Observational study of gene-disease association. (HuGE Navigator)
18804107 These results demonstrate de-novo expression of collagen XVI in glioblastomas as part of the tumor specific remodeling of the ECM.
15165854 interacts with fibrillin-1 and with fibronectin indicating multiple molecular interactions in which this ubiquitously expressed and versatile fibril-associated collagens with interrupted triple helices-collagen can participate
More...

AA Sequence

MWVSWAPGLWLLGLWATFGHGANTGAQCPPSQQEGLKLEHSSSLPANVTGFNLIHRLSLMKTSAIKKIRN      1 - 70
PKGPLILRLGAAPVTQPTRRVFPRGLPEEFALVLTLLLKKHTHQKTWYLFQVTDANGYPQISLEVNSQER     71 - 140
SLELRAQGQDGDFVSCIFPVPQLFDLRWHKLMLSVAGRVASVHVDCSSASSQPLGPRRPMRPVGHVFLGL    141 - 210
DAEQGKPVSFDLQQVHIYCDPELVLEEGCCEILPAGCPPETSKARRDTQSNELIEINPQSEGKVYTRCFC    211 - 280
LEEPQNSEVDAQLTGRISQKAERGAKVHQETAADECPPCVHGARDSNVTLAPSGPKGGKGERGLPGPPGS    281 - 350
KGEKGARGNDCVRISPDAPLQCAEGPKGEKGESGALGPSGLPGSTGEKGQKGEKGDGGIKGVPGKPGRDG    351 - 420
RPGEICVIGPKGQKGDPGFVGPEGLAGEPGPPGLPGPPGIGLPGTPGDPGGPPGPKGDKGSSGIPGKEGP    421 - 490
GGKPGKPGVKGEKGDPCEVCPTLPEGFQNFVGLPGKPGPKGEPGDPVPARGDPGIQGIKGEKGEPCLSCS    491 - 560
SVVGAQHLVSSTGASGDVGSPGFGLPGLPGRAGVPGLKGEKGNFGEAGPAGSPGPPGPVGPAGIKGAKGE    561 - 630
PCEPCPALSNLQDGDVRVVALPGPSGEKGEPGPPGFGLPGKQGKAGERGLKGQKGDAGNPGDPGTPGTTG    631 - 700
RPGLSGEPGVQGPAGPKGEKGDGCTACPSLQGTVTDMAGRPGQPGPKGEQGPEGVGRPGKPGQPGLPGVQ    701 - 770
GPPGLKGVQGEPGPPGRGVQGPQGEPGAPGLPGIQGLPGPRGPPGPTGEKGAQGSPGVKGATGPVGPPGA    771 - 840
SVSGPPGRDGQQGQTGLRGTPGEKGPRGEKGEPGECSCPSQGDLIFSGMPGAPGLWMGSSWQPGPQGPPG    841 - 910
IPGPPGPPGVPGLQGVPGNNGLPGQPGLTAELGSLPIEQHLLKSICGDCVQGQRAHPGYLVEKGEKGDQG    911 - 980
IPGVPGLDNCAQCFLSLERPRAEEARGDNSEGDPGCVGSPGLPGPPGLPGQRGEEGPPGMRGSPGPPGPI    981 - 1050
GPPGFPGAVGSPGLPGLQGERGLTGLTGDKGEPGPPGQPGYPGATGPPGLPGIKGERGYTGSAGEKGEPG   1051 - 1120
PPGSEGLPGPPGPAGPRGERGPQGNSGEKGDQGFQGQPGFPGPPGPPGFPGKVGSPGPPGPQAEKGSEGI   1121 - 1190
RGPSGLPGSPGPPGPPGIQGPAGLDGLDGKDGKPGLRGDPGPAGPPGLMGPPGFKGKTGHPGLPGPKGDC   1191 - 1260
GKPGPPGSTGRPGAEGEPGAMGPQGRPGPPGHVGPPGPPGQPGPAGISAVGLKGDRGATGERGLAGLPGQ   1261 - 1330
PGPPGHPGPPGEPGTDGAAGKEGPPGKQGFYGPPGPKGDPGAAGQKGQAGEKGRAGMPGGPGKSGSMGPV   1331 - 1400
GPPGPAGERGHPGAPGPSGSPGLPGVPGSMGDMVNYDEIKRFIRQEIIKMFDERMAYYTSRMQFPMEMAA   1401 - 1470
APGRPGPPGKDGAPGRPGAPGSPGLPGQIGREGRQGLPGVRGLPGTKGEKGDIGIGIAGENGLPGPPGPQ   1471 - 1540
GPPGYGKMGATGPMGQQGIPGIPGPPGPMGQPGKAGHCNPSDCFGAMPMEQQYPPMKTMKGPFG         1541 - 1604
//

Text Mined References (20)

PMID Year Title
26424749 2015 The NC11 domain of human collagen XVI induces vasculogenic mimicry in oral squamous cell carcinoma cells.
24466237 2014 Collagen XVI induces expression of MMP9 via modulation of AP-1 transcription factors and facilitates invasion of oral squamous cell carcinoma.
23149016 2013 Collagen XVI in health and disease.
22716248 2012 Epidermolysis bullosa - a group of skin diseases with different causes but commonalities in gene expression.
21251976 2011 Induction of type XVI collagen expression facilitates proliferation of oral cancer cells.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19931388 2010 Collagen XVI induces formation of focal contacts on intestinal myofibroblasts isolated from the normal and inflamed intestinal tract.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18804107 2008 Collagen XVI expression is upregulated in glioblastomas and promotes tumor cell adhesion.
16754661 2006 Collagen XVI harbors an integrin alpha1 beta1 recognition site in its C-terminal domains.
More...