Property Summary

NCBI Gene PubMed Count 42
Grant Count 272
R01 Count 107
Funding $47,403,108.49
PubMed Score 644.56
PubTator Score 745.90

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q07075 Q504U2 EAP
Symbols APA
CD249
gp160

Gene

PANTHER Protein Class (3)

PDB

4KX7   4KX8   4KX9   4KXA   4KXB   4KXC   4KXD  

Gene RIF (18)

PMID Text
26311161 The substrate Angiotensin II, the enzymes aminopeptidases-A, B, M as well as IRAP were detected in the jejunal mucosa.
24885240 This study suggests a role for GAP in the neoplastic development of renal tumours and provides additional data for considering the activity and expression of this enzyme of interest in the diagnosis and prognosis of renal neoplasms.
24098452 miR-125b acts as a tumor suppressor in breast tumorigenesis via its novel direct targets ENPEP, CK2-alpha, CCNJ, and MEGF9.
23888046 These results explain the calcium-modulated substrate specificity of APA in central hypertension regulation
21697726 There was no significant alteration in plasma APA activity in the patients with Chagas disease or dilated cardiomyopathies, as compared with that in health controls
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20332099 Observational study of gene-disease association. (HuGE Navigator)
19373777 The activity of glutamyl aminopeptidase was significally increased in head and neck squamous cell carcinoma tissue.
19187443 Over-expressed APA drastically reduces, in a calcium dependent manner, full-length-Abeta but not amyloid-beta precursor protein (APP) intracellular domain in a cell-free model of Abeta production.
18677709 Angiotensin III and aminopeptidase A and N, related converting enzymes, contribute to cell proliferation of prostate cancer and may be implicated in cancer progression.
More...

AA Sequence

MNFAEREGSKRYCIQTKHVAILCAVVVGVGLIVGLAVGLTRSCDSSGDGGPGTAPAPSHLPSSTASPSGP      1 - 70
PAQDQDICPASEDESGQWKNFRLPDFVNPVHYDLHVKPLLEEDTYTGTVSISINLSAPTRYLWLHLRETR     71 - 140
ITRLPELKRPSGDQVQVRRCFEYKKQEYVVVEAEEELTPSSGDGLYLLTMEFAGWLNGSLVGFYRTTYTE    141 - 210
NGQVKSIVATDHEPTDARKSFPCFDEPNKKATYTISITHPKEYGALSNMPVAKEESVDDKWTRTTFEKSV    211 - 280
PMSTYLVCFAVHQFDSVKRISNSGKPLTIYVQPEQKHTAEYAANITKSVFDYFEEYFAMNYSLPKLDKIA    281 - 350
IPDFGTGAMENWGLITYRETNLLYDPKESASSNQQRVATVVAHELVHQWFGNIVTMDWWEDLWLNEGFAS    351 - 420
FFEFLGVNHAETDWQMRDQMLLEDVLPVQEDDSLMSSHPIIVTVTTPDEITSVFDGISYSKGSSILRMLE    421 - 490
DWIKPENFQKGCQMYLEKYQFKNAKTSDFWAALEEASRLPVKEVMDTWTRQMGYPVLNVNGVKNITQKRF    491 - 560
LLDPRANPSQPPSDLGYTWNIPVKWTEDNITSSVLFNRSEKEGITLNSSNPSGNAFLKINPDHIGFYRVN    561 - 630
YEVATWDSIATALSLNHKTFSSADRASLIDDAFALARAQLLDYKVALNLTKYLKREENFLPWQRVISAVT    631 - 700
YIISMFEDDKELYPMIEEYFQGQVKPIADSLGWNDAGDHVTKLLRSSVLGFACKMGDREALNNASSLFEQ    701 - 770
WLNGTVSLPVNLRLLVYRYGMQNSGNEISWNYTLEQYQKTSLAQEKEKLLYGLASVKNVTLLSRYLDLLK    771 - 840
DTNLIKTQDVFTVIRYISYNSYGKNMAWNWIQLNWDYLVNRYTLNNRNLGRIVTIAEPFNTELQLWQMES    841 - 910
FFAKYPQAGAGEKPREQVLETVKNNIEWLKQHRNTIREWFFNLLESG                           911 - 957
//

Text Mined References (46)

PMID Year Title
26311161 2015 Local expression of AP/AngIV/IRAP and effect of AngIV on glucose-induced epithelial transport in human jejunal mucosa.
24885240 2014 Altered glutamyl-aminopeptidase activity and expression in renal neoplasms.
24098452 2013 miR-125b acts as a tumor suppressor in breast tumorigenesis via its novel direct targets ENPEP, CK2-?, CCNJ, and MEGF9.
23888046 2013 Structural insights into central hypertension regulation by human aminopeptidase A.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21886157 2011 Human metabolic individuality in biomedical and pharmaceutical research.
21697726 2011 Does the aminopeptidase A have prognostic and diagnostic value in Chagas disease and other dilated cardiomyopathies?
21572416 2011 Meta-analysis of genome-wide association studies identifies common variants associated with blood pressure variation in east Asians.
21269460 2011 Initial characterization of the human central proteome.
More...