Property Summary

NCBI Gene PubMed Count 53
PubMed Score 28.35
PubTator Score 42.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

 GO Function (1)

Gene RIF (39)

AA Sequence

MPSAKQRGSKGGHGAASPSEKGAHPSGGADDVAKKPPPAPQQPPPPPAPHPQQHPQQHPQNQAHGKGGHR      1 - 70
GGGGGGGKSSSSSSASAAAAAAAASSSASCSRRLGRALNFLFYLALVAAAAFSGWCVHHVLEEVQQVRRS     71 - 140
HQDFSRQREELGQGLQGVEQKVQSLQATFGTFESILRSSQHKQDLTEKAVKQGESEVSRISEVLQKLQNE    141 - 210
ILKDLSDGIHVVKDARERDFTSLENTVEERLTELTKSINDNIAIFTEVQKRSQKEINDMKAKVASLEESE    211 - 280
GNKQDLKALKEAVKEIQTSAKSREWDMEALRSTLQTMESDIYTEVRELVSLKQEQQAFKEAADTERLALQ    281 - 350
ALTEKLLRSEESVSRLPEEIRRLEEELRQLKSDSHGPKEDGGFRHSEAFEALQQKSQGLDSRLQHVEDGV    351 - 420
LSMQVASARQTESLESLLSKSQEHEQRLAALQGRLEGLGSSEADQDGLASTVRSLGETQLVLYGDVEELK    421 - 490
RSVGELPSTVESLQKVQEQVHTLLSQDQAQAARLPPQDFLDRLSSLDNLKASVSQVEADLKMLRTAVDSL    491 - 560
VAYSVKIETNENNLESAKGLLDDLRNDLDRLFVKVEKIHEKV                                561 - 602
//

Text Mined References (62)

PMID Year Title