Property Summary

NCBI Gene PubMed Count 48
Grant Count 429
R01 Count 226
Funding $44,606,249.03
PubMed Score 25.51
PubTator Score 42.13

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q07065 Q504S5 Q53ES6
Symbols p63
CLIMP-63
ERGIC-63

Gene

 GO Function (1)

Gene RIF (36)

PMID Text
25849921 The still rudimentary information of how CLIMP-63 fulfills these different roles, what these are exactly and how post-translational modifications control them, will be discussed.
25008318 Although VIMP can interact with CLIMP-63 and Syn5L, it does not interact with MT-binding ER proteins (such as Reep1) that shape the tubular smooth ER
24838946 revealed that CKAP4 could associate with EGFR at basal status and the complex was reduced upon EGF stimulation, leading to release EGFR into cytoplasm
23921950 Here we report that the combination of p63, a master regulator of epidermal development and differentiation, and KLF4, a regulator of epidermal differentiation, is sufficient to convert dermal fibroblasts to a keratinocyte phenotype.
23913486 Single nucleotide polymorphisms in p63 are implicated in the etiology of nonsyndromic bladder-exstrophy-epispadias complex.
23665508 CKAP4 was correlated with favorable clinical outcome and was an independent predictor for overall survival in hepatic cholangiocarcinoma patients.
23108156 p63 positively regulates desmosome adhesion by directly controlling the expression of several desmosome genes, including Dsp, Dsc3 and Dsg1.
23047949 The results define CLIMP-63 as a novel protein interactor and regulator of Dicer function, involved in maintaining Dicer protein levels in human cells.
22966120 Treatment of airway epitheial cells (AEC) with SP-A, monoclonal antibodies to CKAP4/P63, or CKAP4/P63-specific small interfering RNA decreased the binding of purified alginate exopolysaccharide to AEC.
22438586 CCN2 regulation by antiproliferative factor involves CKAP4 nuclear translocation and binding to the CCN2 promoter.
More...

AA Sequence

MPSAKQRGSKGGHGAASPSEKGAHPSGGADDVAKKPPPAPQQPPPPPAPHPQQHPQQHPQNQAHGKGGHR      1 - 70
GGGGGGGKSSSSSSASAAAAAAAASSSASCSRRLGRALNFLFYLALVAAAAFSGWCVHHVLEEVQQVRRS     71 - 140
HQDFSRQREELGQGLQGVEQKVQSLQATFGTFESILRSSQHKQDLTEKAVKQGESEVSRISEVLQKLQNE    141 - 210
ILKDLSDGIHVVKDARERDFTSLENTVEERLTELTKSINDNIAIFTEVQKRSQKEINDMKAKVASLEESE    211 - 280
GNKQDLKALKEAVKEIQTSAKSREWDMEALRSTLQTMESDIYTEVRELVSLKQEQQAFKEAADTERLALQ    281 - 350
ALTEKLLRSEESVSRLPEEIRRLEEELRQLKSDSHGPKEDGGFRHSEAFEALQQKSQGLDSRLQHVEDGV    351 - 420
LSMQVASARQTESLESLLSKSQEHEQRLAALQGRLEGLGSSEADQDGLASTVRSLGETQLVLYGDVEELK    421 - 490
RSVGELPSTVESLQKVQEQVHTLLSQDQAQAARLPPQDFLDRLSSLDNLKASVSQVEADLKMLRTAVDSL    491 - 560
VAYSVKIETNENNLESAKGLLDDLRNDLDRLFVKVEKIHEKV                                561 - 602
//

Text Mined References (57)

PMID Year Title
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25849921 2015 How many lives does CLIMP-63 have?
25008318 2014 Valosin-containing protein-interacting membrane protein (VIMP) links the endoplasmic reticulum with microtubules in concert with cytoskeleton-linking membrane protein (CLIMP)-63.
24838946 2014 CKAP4 inhibited growth and metastasis of hepatocellular carcinoma through regulating EGFR signaling.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23921950 2014 Highly rapid and efficient conversion of human fibroblasts to keratinocyte-like cells.
23913486 2013 Candidate gene association study implicates p63 in the etiology of nonsyndromic bladder-exstrophy-epispadias complex.
23665508 2013 Expression of cytoskeleton-associated protein 4 is related to lymphatic metastasis and indicates prognosis of intrahepatic cholangiocarcinoma patients after surgery resection.
More...