Property Summary

NCBI Gene PubMed Count 127
PubMed Score 348.62
PubTator Score 188.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
glioblastoma 1.200 1.3e-02
lung adenocarcinoma 1.129 7.5e-05
lung cancer 2.000 2.5e-04
Multiple myeloma 1.820 3.7e-03
nasopharyngeal carcinoma 1.100 3.3e-03
non primary Sjogren syndrome sicca 1.100 1.3e-02
ovarian cancer 2.600 2.3e-05
pancreatic ductal adenocarcinoma liver m... -1.668 6.7e-03
psoriasis 1.200 2.4e-04
Waldenstrons macroglobulinemia 1.317 2.5e-02

Gene RIF (87)

AA Sequence

MLPLLRCVPRVLGSSVAGLRAAAPASPFRQLLQPAPRLCTRPFGLLSVRAGSERRPGLLRPRGPCACGCG      1 - 70
CGSLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIP     71 - 140
PTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVS    141 - 210
FQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVK    211 - 280
SQ                                                                        281 - 282
//

Text Mined References (144)

PMID Year Title