Property Summary

NCBI Gene PubMed Count 117
PubMed Score 332.59
PubTator Score 188.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Mammary Neoplasms 410
Disease Target Count P-value
lung cancer 4473 1.46305576067332E-5
ovarian cancer 8492 2.33252205952201E-5
lung adenocarcinoma 2714 7.50918645384263E-5
psoriasis 6685 2.39564369732703E-4
nasopharyngeal carcinoma 1056 0.00325599899737557
Multiple myeloma 1328 0.0037353210758862
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00666184358035033
non primary Sjogren syndrome sicca 840 0.0129466081221045
glioblastoma 5572 0.0134552374835929
Waldenstrons macroglobulinemia 765 0.0247285531176145

Expression

  Differential Expression (10)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.317 0.025
Multiple myeloma 1.820 0.004
psoriasis 1.200 0.000
glioblastoma 1.200 0.013
pancreatic ductal adenocarcinoma liver m... -1.668 0.007
lung cancer 2.200 0.000
non primary Sjogren syndrome sicca 1.100 0.013
nasopharyngeal carcinoma 1.100 0.003
lung adenocarcinoma 1.129 0.000
ovarian cancer 2.600 0.000

Synonym

Accession Q07021 Q2HXR8 Q9NNY8
Symbols p32
HABP1
gC1qR
GC1QBP
SF2p32
gC1Q-R

Gene

PDB

1P32   3RPX  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA Inparanoid

Gene RIF (78)

PMID Text
26753982 C1QBP interacts with DLAT and regulates the enzyme activity of pyruvate dehydrogenase.
26497555 Sp1-ZNF32-C1QBP axis protects against oxidative stress/apoptosis in hepatocellular carcinoma cells.
26085152 p32 appeared to be a core component of herpesvirus nuclear egress complexes, like UL31 and UL34 homologs in other herpesviruses, and to play multiple roles in herpesvirus nuclear egress.
25909887 Findings highlight a cytoprotective role of p32 under starvation conditions by regulating ULK1 stability, and uncover a crucial role of the p32-ULK1-autophagy axis in coordinating stress response, cell survival and mitochondrial homeostasis.
25794640 HABP1 protein high expression may contribute to the tumor progression and poor prognosis of TNBC, especially in predicting prognosis in TNBCs without lymph node metastasis.
25573962 our findings suggest that the C1QBP protein could be a potential proliferative marker in breast cancer
25528767 Data show that p32 hyaluronan binding protein (p32) is a direct transcriptional target of oncogene Myc and that high level of Myc in malignant brain cancers correlates with high expression of p32.
25497084 data suggest that C1QBP is a novel regulator of YBX1, and the expression of C1QBP and the nuclear expression of YBX1 could both be used as independent prognostic makers for cancer progression in the RCC patients
25355598 Our results indicated that overexpression of HABP1 may serve as a new biomarker to predict the progression and prognosis of endometrial cancer.
25355318 Interaction between HSV-1 ICP34.5 and p32 leads to the disintegration of nuclear lamina and facilitates the nuclear egress of HSV-1 particles.
More...

AA Sequence

MLPLLRCVPRVLGSSVAGLRAAAPASPFRQLLQPAPRLCTRPFGLLSVRAGSERRPGLLRPRGPCACGCG      1 - 70
CGSLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIP     71 - 140
PTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVS    141 - 210
FQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVK    211 - 280
SQ                                                                        281 - 282
//

Text Mined References (134)

PMID Year Title
26753982 2016 Identification of a novel mitochondrial interacting protein of C1QBP using subcellular fractionation coupled with CoIP-MS.
26497555 2015 ZNF32 protects against oxidative stress-induced apoptosis by modulating C1QBP transcription.
26085152 2015 Role of Host Cell p32 in Herpes Simplex Virus 1 De-Envelopment during Viral Nuclear Egress.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25909887 2015 Chaperone-like protein p32 regulates ULK1 stability and autophagy.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25794640 2015 Elevated expression of HABP1 is a novel prognostic indicator in triple-negative breast cancers.
25573962 2015 Complement component 1, q subcomponent binding protein is a marker for proliferation in breast cancer.
25528767 2015 Mitochondrial p32 is upregulated in Myc expressing brain cancers and mediates glutamine addiction.
25497084 2015 C1QBP negatively regulates the activation of oncoprotein YBX1 in the renal cell carcinoma as revealed by interactomics analysis.
More...