Property Summary

NCBI Gene PubMed Count 24
PubMed Score 25.75
PubTator Score 25.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
acute quadriplegic myopathy 1.029 4.9e-05
colon cancer 1.500 1.6e-02
diabetes mellitus 1.400 7.2e-03
intraductal papillary-mucinous neoplasm ... -1.200 6.2e-03
lung cancer 1.300 6.9e-04
Multiple myeloma 1.573 4.9e-03
osteosarcoma 1.332 2.9e-06
ovarian cancer -1.500 6.0e-06
psoriasis 1.200 2.7e-04
sonic hedgehog group medulloblastoma 1.100 8.8e-06
Waldenstrons macroglobulinemia 1.377 1.7e-02

Gene RIF (5)

AA Sequence

MGVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNRPPLSLSRMIRKM      1 - 70
KLPGRENKTAVVVGTITDDVRVQEVPKLKVCALRVTSRARSRILRAGGKILTFDQLALDSPKGCGTVLLS     71 - 140
GPRKGREVYRHFGKAPGTPHSHTKPYVRSKGRKFERARGRRASRGYKN                          141 - 188
//

Text Mined References (36)

PMID Year Title