Property Summary

NCBI Gene PubMed Count 104
Grant Count 337
R01 Count 196
Funding $38,131,877.18
PubMed Score 714.23
PubTator Score 227.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
cutaneous lupus erythematosus 1.200 0.008
tuberculosis -2.000 0.000
lung cancer -2.400 0.000
interstitial cystitis 2.200 0.001
lung adenocarcinoma 1.100 0.000
group 4 medulloblastoma 1.100 0.026
ulcerative colitis 1.500 0.000
psoriasis 2.700 0.000

Synonym

Accession Q07011
Symbols ILA
4-1BB
CD137
CDw137

Gene

Gene RIF (82)

PMID Text
26970765 Studies suggest that adoptive T cell therapy and CD137 antigen offer much opportunity to raise the efficacy of current cancer immunotherapies.
26885860 in complex with T cell receptor, promotes memory T cells, cell respiration, fatty acid oxidation and mitochondrial biogenesis
26561569 Triple costimulation via CD80, 4-1BB, and CD83 ligand elicits the long-term growth of Vgamma9Vdelta2 T cells in low levels of IL-2.
26467721 These studies provide the first direct evidence that ligation of tumour necrosis factor superfamily members and their cognate receptors is important for the control of viral lytic replication.
26113085 As a result of becoming activated, transferred human T lymphocytes express the inducible surface antigens hPD-1 and hCD137 on their plasma membrane.
25939063 Our results provide biological explanations for the antitumor effects of CD19 CARs and for the observations that CD19 CAR T cells incorporating the 4-1BB costimulatory domain are more persistent than those incorporating CD28 in clinical trials.
25409517 upregulation of CD137 expression through LMP1 by EBV promotes cell survival in T or NK cells
25367298 Based on CD137 or CD154 expression.
25032953 Human genetic evidence for involvement of CD137 in atherosclerosis
25019989 DENV C disrupts Daxx and NF-kappaB interaction to induce CD137-mediated apoptosis during DENV infection
More...

AA Sequence

MGNSCYNIVATLLLVLNFERTRSLQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKG      1 - 70
VFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCS     71 - 140
LDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQIISFFLALTSTALLFLLFFLTLRF    141 - 210
SVVKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL                             211 - 255
//

Text Mined References (105)

PMID Year Title
26970765 2016 Anti-CD137 monoclonal antibodies and adoptive T cell therapy: a perfect marriage?
26885860 2016 Distinct Signaling of Coreceptors Regulates Specific Metabolism Pathways and Impacts Memory Development in CAR T Cells.
26561569 2016 Triple costimulation via CD80, 4-1BB, and CD83 ligand elicits the long-term growth of V?9V?2 T cells in low levels of IL-2.
26467721 2015 OX40 and 4-1BB downregulate Kaposi’s sarcoma-associated herpesvirus replication in lymphatic endothelial cells, but 4-1BB and not OX40 inhibits viral replication in B-cells.
26113085 2015 Nivolumab and Urelumab Enhance Antitumor Activity of Human T Lymphocytes Engrafted in Rag2-/-IL2R?null Immunodeficient Mice.
25939063 2015 4-1BB costimulation ameliorates T cell exhaustion induced by tonic signaling of chimeric antigen receptors.
25409517 2014 CD137 expression is induced by Epstein-Barr virus infection through LMP1 in T or NK cells and mediates survival promoting signals.
25367298 2015 Multispecific Aspergillus T cells selected by CD137 or CD154 induce protective immune responses against the most relevant mold infections.
25032953 2014 Human genetic evidence for involvement of CD137 in atherosclerosis.
25019989 2014 Dengue virus disrupts Daxx and NF-?B interaction to induce CD137-mediated apoptosis.
More...