Property Summary

NCBI Gene PubMed Count 109
PubMed Score 769.99
PubTator Score 227.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (8)

Disease log2 FC p
cutaneous lupus erythematosus 1.200 7.7e-03
group 4 medulloblastoma 1.100 2.6e-02
interstitial cystitis 2.200 1.1e-03
lung adenocarcinoma 1.100 1.2e-07
lung cancer 1.800 1.0e-03
psoriasis 2.700 4.0e-143
tuberculosis -2.000 1.3e-06
ulcerative colitis 1.500 4.7e-05

 CSPA Cell Line (2)

Protein-protein Interaction (4)

Gene RIF (86)

AA Sequence

MGNSCYNIVATLLLVLNFERTRSLQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKG      1 - 70
VFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCS     71 - 140
LDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQIISFFLALTSTALLFLLFFLTLRF    141 - 210
SVVKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL                             211 - 255
//

Text Mined References (110)

PMID Year Title