Property Summary

NCBI Gene PubMed Count 20
PubMed Score 10.76
PubTator Score 10.44

Knowledge Summary

Patent (2,352)

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma -1.800 0.000
posterior fossa group B ependymoma -1.700 0.000
sonic hedgehog group medulloblastoma -2.100 0.000
atypical teratoid/rhabdoid tumor -1.500 0.000
Pick disease -1.200 0.001
pituitary cancer 2.400 0.000

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (3)

PMID Text
19460752 Knockdown of cyclin-dependent kinase 18 (CDK18) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
16766195 PCTAIRE 3 is aassociated kinase that modulates tau phosphorylation in Alzeheimer's disease.
15019984 Expression of PCTAIRE 3a (474 amino acids) was evident throughout the brain and in the majority of tissues analyzed, while spliced isoform PCTAIRE 3b (504 amino acids) was limited to several subcortical nuclei of the basal gangli and the spinal cord.

AA Sequence

MNKMKNFKRRFSLSVPRTETIEESLAEFTEQFNQLHNRRNENLQLGPLGRDPPQECSTFSPTDSGEEPGQ      1 - 70
LSPGVQFQRRQNQRRFSMEDVSKRLSLPMDIRLPQEFLQKLQMESPDLPKPLSRMSRRASLSDIGFGKLE     71 - 140
TYVKLDKLGEGTYATVFKGRSKLTENLVALKEIRLEHEEGAPCTAIREVSLLKNLKHANIVTLHDLIHTD    141 - 210
RSLTLVFEYLDSDLKQYLDHCGNLMSMHNVKIFMFQLLRGLAYCHHRKILHRDLKPQNLLINERGELKLA    211 - 280
DFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSTEYSTPIDMWGVGCIHYEMATGRPLFPGSTVKEELHL    281 - 350
IFRLLGTPTEETWPGVTAFSEFRTYSFPCYLPQPLINHAPRLDTDGIHLLSSLLLYESKSRMSAEAALSH    351 - 420
SYFRSLGERVHQLEDTASIFSLKEIQLQKDPGYRGLAFQQPGRGKNRRQSIF                      421 - 472
//

Text Mined References (27)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24823311 2014 Genome-wide association study of plasma N6 polyunsaturated fatty acids within the cohorts for heart and aging research in genomic epidemiology consortium.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
19884882 2009 Cyclin-dependent kinases: a family portrait.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...