Property Summary

Ligand Count 2
NCBI Gene PubMed Count 22
PubMed Score 12.13
PubTator Score 10.44

Knowledge Summary

Patent (2,352)

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid/rhabdoid tumor -1.500 2.1e-04
ependymoma -1.500 3.9e-09
group 4 medulloblastoma -1.500 9.0e-03
malignant mesothelioma -1.800 6.0e-07
Pick disease -1.200 1.3e-03
pituitary cancer 2.400 1.5e-06

Gene RIF (5)

AA Sequence

MNKMKNFKRRFSLSVPRTETIEESLAEFTEQFNQLHNRRNENLQLGPLGRDPPQECSTFSPTDSGEEPGQ      1 - 70
LSPGVQFQRRQNQRRFSMEDVSKRLSLPMDIRLPQEFLQKLQMESPDLPKPLSRMSRRASLSDIGFGKLE     71 - 140
TYVKLDKLGEGTYATVFKGRSKLTENLVALKEIRLEHEEGAPCTAIREVSLLKNLKHANIVTLHDLIHTD    141 - 210
RSLTLVFEYLDSDLKQYLDHCGNLMSMHNVKIFMFQLLRGLAYCHHRKILHRDLKPQNLLINERGELKLA    211 - 280
DFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSTEYSTPIDMWGVGCIHYEMATGRPLFPGSTVKEELHL    281 - 350
IFRLLGTPTEETWPGVTAFSEFRTYSFPCYLPQPLINHAPRLDTDGIHLLSSLLLYESKSRMSAEAALSH    351 - 420
SYFRSLGERVHQLEDTASIFSLKEIQLQKDPGYRGLAFQQPGRGKNRRQSIF                      421 - 472
//

Text Mined References (29)

PMID Year Title