Property Summary

NCBI Gene PubMed Count 108
Grant Count 57
R01 Count 41
Funding $4,442,478.28
PubMed Score 143.22
PubTator Score 123.96

Knowledge Summary

Patent

No data available

Expression

Gene RIF (83)

PMID Text
26841870 Sox4 was also able to promote b-catenin-mediated transcription of the Slug gene through formation of transcriptional complexes with b-catenin and p300, independent of TCF4 status
26823713 miR-211 could inhibit gastric cancer cell proliferation and invasion partially by down-regulating SOX4.
26701805 SOX4 expression was induced by Pten loss as a result of the activation of PI3K-AKT-mTOR signaling
26681916 data show that Sox4 is an important regulator of the bladder CSC properties and it may serve as a biomarker of the aggressive phenotype in bladder cancer
26648239 The miR-335 expression was inversely correlated with Sox4 expression in the identical clinical specimens, but it was not related to the prognosis. Sox4/Ezh2 axis was closely associated with the prognosis in pancreatic cancer patients
26583330 Results suggested that SOX4 functions to modulate cancer proliferation by regulation of cell cycle, and inhibit cancer cell sensitivity to therapeutic drug via upregulation of ABCG2.
26578818 Overexpression of SOX4 correlates with clinical stages in nasopharyngeal carcinoma and promotes cell migration of CNE2 cells.
26555193 SOX4 may contribute to oncogenic phenotypes of head and neck squamous cell carcinoma cells by promoting cell survival and causing chemoradioresistance. It could be a potential prognostic marker for oral squamous cell carcinoma .
26514989 Sox4 enhances chondrogenic differentiation and proliferation of human synovium-derived stem cell via activation of long noncoding RNA DANCR
26464665 Our findings indicated that miR-204 negatively regulates SOX4 and inhibited proliferation, migration and invasion of T-cell acute lymphoblastic leukaemia cell lines.
More...

AA Sequence

MVQQTNNAENTEALLAGESSDSGAGLELGIASSPTPGSTASTGGKADDPSWCKTPSGHIKRPMNAFMVWS      1 - 70
QIERRKIMEQSPDMHNAEISKRLGKRWKLLKDSDKIPFIREAERLRLKHMADYPDYKYRPRKKVKSGNAN     71 - 140
SSSSAAASSKPGEKGDKVGGSGGGGHGGGGGGGSSNAGGGGGGASGGGANSKPAQKKSCGSKVAGGAGGG    141 - 210
VSKPHAKLILAGGGGGGKAAAAAAASFAAEQAGAAALLPLGAAADHHSLYKARTPSASASASSAASASAA    211 - 280
LAAPGKHLAEKKVKRVYLFGGLGTSSSPVGGVGAGADPSDPLGLYEEEGAGCSPDAPSLSGRSSAASSPA    281 - 350
AGRSPADHRGYASLRAASPAPSSAPSHASSSASSHSSSSSSSGSSSSDDEFEDDLLDLNPSSNFESMSLG    351 - 420
SFSSSSALDRDLDFNFEPGSGSHFEFPDYCTPEVSEMISGDWLESSISNLVFTY                    421 - 474
//

Text Mined References (108)

PMID Year Title
26841870 2016 Cooperation of Sox4 with ?-catenin/p300 complex in transcriptional regulation of the Slug gene during divergent sarcomatous differentiation in uterine carcinosarcoma.
26823713 2015 MiR-211 inhibits cell proliferation and invasion of gastric cancer by down-regulating SOX4.
26701805 2016 SOX4 Is Essential for Prostate Tumorigenesis Initiated by PTEN Ablation.
26681916 2015 Sox4 Expression Confers Bladder Cancer Stem Cell Properties and Predicts for Poor Patient Outcome.
26648239 2016 A crucial epithelial to mesenchymal transition regulator, Sox4/Ezh2 axis is closely related to the clinical outcome in pancreatic cancer patients.
26583330 2015 SOX4 contributes to the progression of cervical cancer and the resistance to the chemotherapeutic drug through ABCG2.
26578818 2015 Upregulated Expression of SOX4 Is Associated with Tumor Growth and Metastasis in Nasopharyngeal Carcinoma.
26555193 2015 SOX4 expression is associated with treatment failure and chemoradioresistance in oral squamous cell carcinoma.
26514989 2015 Sox4 enhances chondrogenic differentiation and proliferation of human synovium-derived stem cell via activation of long noncoding RNA DANCR.
26464665 2015 MicroRNA-204 inhibits cell proliferation in T-cell acute lymphoblastic leukemia by down-regulating SOX4.
More...