Property Summary

NCBI Gene PubMed Count 126
PubMed Score 164.19
PubTator Score 123.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Adenoid Cystic Carcinoma 99

Expression

  Differential Expression (34)

Gene RIF (101)

AA Sequence

MVQQTNNAENTEALLAGESSDSGAGLELGIASSPTPGSTASTGGKADDPSWCKTPSGHIKRPMNAFMVWS      1 - 70
QIERRKIMEQSPDMHNAEISKRLGKRWKLLKDSDKIPFIREAERLRLKHMADYPDYKYRPRKKVKSGNAN     71 - 140
SSSSAAASSKPGEKGDKVGGSGGGGHGGGGGGGSSNAGGGGGGASGGGANSKPAQKKSCGSKVAGGAGGG    141 - 210
VSKPHAKLILAGGGGGGKAAAAAAASFAAEQAGAAALLPLGAAADHHSLYKARTPSASASASSAASASAA    211 - 280
LAAPGKHLAEKKVKRVYLFGGLGTSSSPVGGVGAGADPSDPLGLYEEEGAGCSPDAPSLSGRSSAASSPA    281 - 350
AGRSPADHRGYASLRAASPAPSSAPSHASSSASSHSSSSSSSGSSSSDDEFEDDLLDLNPSSNFESMSLG    351 - 420
SFSSSSALDRDLDFNFEPGSGSHFEFPDYCTPEVSEMISGDWLESSISNLVFTY                    421 - 474
//

Text Mined References (126)

PMID Year Title