Property Summary

NCBI Gene PubMed Count 38
PubMed Score 311.83
PubTator Score 68.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Ataxia 15
Disease Target Count P-value
breast carcinoma 1614 2.7778922302112E-23
Breast cancer 3099 4.60133975461911E-12
non-small cell lung cancer 2798 4.66220412407406E-11
oligodendroglioma 2849 1.45463646996647E-8
astrocytoma 1493 2.69693400213289E-8
ulcerative colitis 2087 1.88609450142862E-7
adrenocortical carcinoma 1427 1.01760612521935E-6
lung cancer 4473 2.46038519301942E-6
medulloblastoma 1524 2.54246992649567E-4
cystic fibrosis 1670 4.43840256390798E-4
Atopic dermatitis 944 0.0012019824222991
interstitial cystitis 2299 0.00157322733705042
atypical teratoid / rhabdoid tumor 4369 0.00305266580454585
primitive neuroectodermal tumor 3031 0.0051009047381703
non primary Sjogren syndrome sicca 840 0.00523935082626024
medulloblastoma, large-cell 6234 0.00779168921747294
gastric carcinoma 832 0.0203120053083155
primary pancreatic ductal adenocarcinoma 1271 0.0239958193182299
tuberculosis and treatment for 6 months 686 0.0270429422392279
glioblastoma 5572 0.0312058339353501
ependymoma 2514 0.0390915136341635
adrenocortical adenoma 134 0.0400501920143058
chronic rhinosinusitis 512 0.0492232394336676

Expression

  Differential Expression (23)

Disease log2 FC p
ependymoma -2.300 0.039
oligodendroglioma -2.100 0.000
astrocytoma -1.700 0.000
glioblastoma -1.900 0.031
medulloblastoma -3.300 0.000
atypical teratoid / rhabdoid tumor -2.800 0.003
medulloblastoma, large-cell -3.600 0.008
primitive neuroectodermal tumor -3.300 0.005
Atopic dermatitis -1.500 0.001
adrenocortical adenoma -1.280 0.040
adrenocortical carcinoma -3.049 0.000
tuberculosis and treatment for 6 months -1.100 0.027
primary pancreatic ductal adenocarcinoma 1.006 0.024
non-small cell lung cancer -1.874 0.000
lung cancer -4.200 0.000
Breast cancer -3.700 0.000
interstitial cystitis 2.100 0.002
cystic fibrosis 2.500 0.000
non primary Sjogren syndrome sicca -2.500 0.005
breast carcinoma -2.200 0.000
gastric carcinoma 2.600 0.020
ulcerative colitis 3.300 0.000
chronic rhinosinusitis -1.901 0.049

Synonym

Accession Q06889 A8K8U9 B4DHJ5 E7EW38 Q2M3W2 EGR-3
Symbols EGR-3
PILOT

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Xenopus OMA EggNOG

Gene RIF (35)

PMID Text
26474411 These findings support previously reported associations between EGR3 and schizophrenia.
25633035 EGR3 promotes excessive production of IL6 and IL8 observed during the progression of prostate cancer.
25613138 The gene expression of early growth response 3 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
24886494 Data shows association of Egr3 genetic polymorphisms and coronary artery disease in the Uygur and Han of China
23962955 Genetic variation in EGR3 may affect prefrontal function through neurodevelopment
23935197 These data suggest that type I IFN stimulation induces a rapid recruitment of a repressive Egr3/Nab1 complex that silences transcription from the ifngr1 promoter.
23906810 These results provide the first evidence that Egr-3, is up-regulated in scleroderma and is necessary and sufficient for profibrotic responses.
23904169 Our results suggest that Egr-3 is a transcription factor associated with TGF-beta1 expression and in vivo regulatory activity
23485457 EGR2 and EGR3 are regulated by NFkappaB and MAPK signalling pathways downstream of TNFalpha stimulation in breast adipose fibroblasts, and this in turn is upstream of CYP19A1 transcription via PI.4
23460371 Decreased EGR3 expression might play a critical role in the differentiation, proliferation, metastasis and progression of gastric cancer cells.
More...

AA Sequence

MTGKLAEKLPVTMSSLLNQLPDNLYPEEIPSALNLFSGSSDSVVHYNQMATENVMDIGLTNEKPNPELSY      1 - 70
SGSFQPAPGNKTVTYLGKFAFDSPSNWCQDNIISLMSAGILGVPPASGALSTQTSTASMVQPPQGDVEAM     71 - 140
YPALPPYSNCGDLYSEPVSFHDPQGNPGLAYSPQDYQSAKPALDSNLFPMIPDYNLYHHPNDMGSIPEHK    141 - 210
PFQGMDPIRVNPPPITPLETIKAFKDKQIHPGFGSLPQPPLTLKPIRPRKYPNRPSKTPLHERPHACPAE    211 - 280
GCDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKR    281 - 350
HAKIHLKQKEKKAEKGGAPSASSAPPVSLAPVVTTCA                                     351 - 387
//

Text Mined References (40)

PMID Year Title
26474411 2015 Association of SNPs in EGR3 and ARC with Schizophrenia Supports a Biological Pathway for Schizophrenia Risk.
25633035 2015 Early Growth Response 3 regulates genes of inflammation and directly activates IL6 and IL8 expression in prostate cancer.
24886494 2014 Association of Egr3 genetic polymorphisms and coronary artery disease in the Uygur and Han of China.
23962955 2014 Association of decreased prefrontal hemodynamic response during a verbal fluency task with EGR3 gene polymorphism in patients with schizophrenia and in healthy individuals.
23935197 2013 Type I IFNs downregulate myeloid cell IFN-? receptor by inducing recruitment of an early growth response 3/NGFI-A binding protein 1 complex that silences ifngr1 transcription.
23906810 2013 Early growth response 3 (Egr-3) is induced by transforming growth factor-? and regulates fibrogenic responses.
23904169 2013 Transcription factor early growth response 3 is associated with the TGF-?1 expression and the regulatory activity of CD4-positive T cells in vivo.
23485457 2013 NF?B and MAPK signalling pathways mediate TNF?-induced Early Growth Response gene transcription leading to aromatase expression.
23460371 2013 Decreased EGR3 expression is related to poor prognosis in patients with gastric cancer.
23342084 2013 Early growth response 3 (Egr3) is highly over-expressed in non-relapsing prostate cancer but not in relapsing prostate cancer.
More...