Property Summary

NCBI Gene PubMed Count 43
PubMed Score 332.35
PubTator Score 68.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
adrenocortical adenoma -1.280 4.0e-02
adrenocortical carcinoma -3.049 1.0e-06
astrocytoma -1.700 2.7e-08
Atopic dermatitis -1.500 1.2e-03
atypical teratoid / rhabdoid tumor -2.800 3.1e-03
Breast cancer -2.800 2.5e-02
breast carcinoma -2.200 2.8e-23
chronic rhinosinusitis -1.901 4.9e-02
cystic fibrosis 2.500 4.4e-04
ependymoma -2.300 3.9e-02
gastric carcinoma 2.100 2.2e-03
glioblastoma -1.900 3.1e-02
group 4 medulloblastoma -3.100 7.4e-03
interstitial cystitis 2.100 1.6e-03
lung cancer -4.100 2.1e-05
medulloblastoma, large-cell -3.600 7.8e-03
non primary Sjogren syndrome sicca -2.500 5.2e-03
non-small cell lung cancer -1.874 4.7e-11
oligodendroglioma -1.500 2.4e-02
primary pancreatic ductal adenocarcinoma 1.006 2.4e-02
primitive neuroectodermal tumor -3.300 5.1e-03
tuberculosis and treatment for 6 months -1.100 2.7e-02
ulcerative colitis 3.300 1.9e-07

Gene RIF (40)

AA Sequence

MTGKLAEKLPVTMSSLLNQLPDNLYPEEIPSALNLFSGSSDSVVHYNQMATENVMDIGLTNEKPNPELSY      1 - 70
SGSFQPAPGNKTVTYLGKFAFDSPSNWCQDNIISLMSAGILGVPPASGALSTQTSTASMVQPPQGDVEAM     71 - 140
YPALPPYSNCGDLYSEPVSFHDPQGNPGLAYSPQDYQSAKPALDSNLFPMIPDYNLYHHPNDMGSIPEHK    141 - 210
PFQGMDPIRVNPPPITPLETIKAFKDKQIHPGFGSLPQPPLTLKPIRPRKYPNRPSKTPLHERPHACPAE    211 - 280
GCDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKR    281 - 350
HAKIHLKQKEKKAEKGGAPSASSAPPVSLAPVVTTCA                                     351 - 387
//

Text Mined References (45)

PMID Year Title