Property Summary

NCBI Gene PubMed Count 144
Grant Count 85
R01 Count 49
Funding $8,398,105.21
PubMed Score 365.16
PubTator Score 192.32

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q06830 B5BU26 D3DPZ8 P35703 Q2V576 Q5T154 Q5T155
Symbols PAG
PAGA
PAGB
PRX1
PRXI
MSP23
NKEFA
TDPX2
NKEF-A

Gene

PANTHER Protein Class (2)

PDB

2RII   3HY2   4XCS  

 GWAS Trait (1)

Gene RIF (101)

PMID Text
26689287 Our data suggest that PRX1 inactivation could represent an interesting strategy to enhance cancer cell sensitivity to vitK3, providing a potential new therapeutic perspective for this old molecule.
26617696 The data indicate that Prdx1 may contribute to the development and progression of hilar cholangiocarcinoma
26548861 Data show the protein partners of human Prx1 and Prx2 and identified three sequence motifs, or combination thereof in Prxs partners, namely: CXXC, PXXP, and LXXLL. that can be important for protein localization, function and biological pathways. [review]
26478675 PRDX1 was overexpressed in the tumor tissues of liver cancer and served as an independent poor prognostic factor for overall survival. PRDX1 can be modified by small ubiquitin-like modifier to play specific roles in hepatocarcinogenesis.
26301632 the protein and mRNA levels of PRDX1 were significantly elevated under insulin-resistant conditions
26170166 This review will summarize the molecular basis of differences in the affinity of Srx for individual Prx and the role of individual component of the Srx-Prx system in tumor progression and metastasis.
26159854 The immunohistochemistry-based validation using tissue microarray slides in oral squamous cell carcinoma revealed overexpression of the RAB2A and PRDX1 gene in 80 and 68 % of the tested clinical cases, respectively.
26150388 Dephosphorylation of PrxI by okadaic acid-sensitive phosphatases during late mitosis again shields the centrosome from H2O2 and thereby allows the reactivation of Cdk1-opposing phosphatases at the organelle.
26117319 TRX-1/PRX-1 levels are associated with NADPH oxidase-activity in vivo and in vitro in atherosclerosis.
25579166 These findings that Prdx1 may be involved in tumorigenesis in esophageal squamous cell carcinoma
More...

AA Sequence

MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLN      1 - 70
CQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILR     71 - 140
QITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK               141 - 199
//

Text Mined References (152)

PMID Year Title
26689287 2015 PRX1 knockdown potentiates vitamin K3 toxicity in cancer cells: a potential new therapeutic perspective for an old drug.
26617696 2015 Overexpression of Prdx1 in hilar cholangiocarcinoma: a predictor for recurrence and prognosis.
26548861 2016 Human Peroxiredoxins 1 and 2 and Their Interacting Protein Partners; Through Structure Toward Functions of Biological Complexes.
26478675 2015 Aberrant expression of peroxiredoxin 1 and its clinical implications in liver cancer.
26301632 2015 PRDX1 is involved in palmitate induced insulin resistance via regulating the activity of p38MAPK in HepG2 cells.
26170166 2015 The sulfiredoxin-peroxiredoxin (Srx-Prx) axis in cell signal transduction and cancer development.
26159854 2015 Identification of RAB2A and PRDX1 as the potential biomarkers for oral squamous cell carcinoma using mass spectrometry-based comparative proteomic approach.
26150388 2015 Control of the pericentrosomal H2O2 level by peroxiredoxin I is critical for mitotic progression.
26117319 2015 Thioredoxin-1/peroxiredoxin-1 as sensors of oxidative stress mediated by NADPH oxidase activity in atherosclerosis.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
More...