Property Summary

NCBI Gene PubMed Count 157
PubMed Score 398.97
PubTator Score 192.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
group 3 medulloblastoma 1.100 5.7e-04
intraductal papillary-mucinous carcinoma... 1.500 3.7e-03
invasive ductal carcinoma 1.600 1.1e-04
lung cancer 1.900 4.7e-03
Multiple myeloma 1.385 1.2e-02
ovarian cancer -1.100 8.8e-04
pancreatic cancer 1.100 2.5e-03
pancreatic ductal adenocarcinoma liver m... -1.323 2.6e-02
Waldenstrons macroglobulinemia 1.669 1.9e-03

 GWAS Trait (1)

Gene RIF (113)

AA Sequence

MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLN      1 - 70
CQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILR     71 - 140
QITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK               141 - 199
//

Text Mined References (167)

PMID Year Title