Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.28
PubTator Score 5.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.100 8.7e-03
glioblastoma -1.300 8.2e-04
group 3 medulloblastoma 1.300 1.1e-02
intraductal papillary-mucinous adenoma (... 1.100 2.7e-03
osteosarcoma -2.378 2.4e-07
ovarian cancer -1.100 8.8e-04
progressive supranuclear palsy -1.200 1.8e-02

Gene RIF (1)

AA Sequence

MNKVEQKSQESVSFKDVTVGFTQEEWQHLDPSQRALYRDVMLENYSNLVSVGYCVHKPEVIFRLQQGEEP      1 - 70
WKQEEEFPSQSFPVWTADHLKERSQENQSKHLWEVVFINNEMLTKEQGDVIGIPFNVDVSSFPSRKMFCQ     71 - 140
CDSCGMSFNTVSELVISKINYLGKKSDEFNACGKLLLNIKHDETHTQEKNEVLKNRNTLSHHEETLQHEK    141 - 210
IQTLEHNFEYSICQETLLEKAVFNTQKRENAEENNCDYNEFGRTLCDSSSLLFHQISPSRDNHYEFSDCE    211 - 280
KFLCVKSTLSKPHGVSMKHYDCGESGNNFRRKLCLSHLQKGDKGEKHFECNECGKAFWEKSHLTRHQRVH    281 - 350
TGQKPFQCNECEKAFWDKSNLTKHQRSHTGEKPFECNECGKAFSHKSALTLHQRTHTGEKPYQCNACGKT    351 - 420
FCQKSDLTKHQRTHTGLKPYECYECGKSFRVTSHLKVHQRTHTGEKPFECLECGKSFSEKSNLTQHQRIH    421 - 490
IGDKSYECNACGKTFYHKSLLTRHQIIHTGWKPYECYECGKTFCLKSDLTVHQRTHTGQKPFACPECGKF    491 - 560
FSHKSTLSQHYRTHTGEKPYECHECGKIFYNKSYLTKHNRTHTGEKPYECNECGKAFYQKSQLTQHQRIH    561 - 630
IGEKPYKCNECGKAFCHKSALIVHQRTHTQEKPYKCNECGKSFCVKSGLIFHERKHTGEKPYECNECGKF    631 - 700
FRHKSSLTVHHRAHTGEKSCQCNECGKIFYRKSELAQHQRSHTGEKPYECNTCRKTFSQKSNLIVHQRRH    701 - 770
IGENLMNEMDIRNFQPQVSLHNASEYSHCGESPDDILNVQ                                  771 - 810
//

Text Mined References (12)

PMID Year Title