Property Summary

NCBI Gene PubMed Count 182
PubMed Score 442.11
PubTator Score 335.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count P-value
ovarian cancer 8520 3.6e-11
osteosarcoma 7950 1.3e-07
nephrosclerosis 333 5.5e-04
psoriasis 6694 1.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Kidney disease 430 0.0 3.0

Expression

  Differential Expression (4)

Disease log2 FC p
nephrosclerosis -1.006 5.5e-04
osteosarcoma 1.692 1.3e-07
ovarian cancer 1.900 3.6e-11
psoriasis 2.000 1.1e-03

 GO Component (2)

Gene RIF (153)

AA Sequence

MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGS      1 - 70
IRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPF     71 - 140
NLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDDSDQDSCRLSI    141 - 210
DSQSSSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQGLYPLPLLNSTLDDGKATLTP    211 - 280
SNTPLGRNLSTHQTYPVVADPHSPFAIKQETPEVSSSSSTPSSLSSSAFLDLQQVGSGVPPFNAFPHAAS    281 - 350
VYGQFTGQALLSGREMVGPTLPGYPPHIPTSGQGSYASSAIAGMVAGSEYSGNAYGHTPYSSYSEAWRFP    351 - 420
NSSLLSSPYYYSSTSRPSAPPTTATAFDHL                                            421 - 450
//

Text Mined References (183)

PMID Year Title