Property Summary

NCBI Gene PubMed Count 161
Grant Count 56
R01 Count 49
Funding $5,564,154.35
PubMed Score 404.02
PubTator Score 335.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
nephrosclerosis -1.006 0.001
psoriasis 2.000 0.001
osteosarcoma 1.692 0.000
ovarian cancer 2.500 0.000

Synonym

Gene

PDB

2K27  

 GO Component (2)

Gene RIF (132)

PMID Text
26910219 PAX8 is expressed in the majority of benign, premalignant, and malignant endocervical glandular lesions.
26404914 a substantial minority of solitary fibrous tumors express nuclear PAX8 and PAX2
26362610 PAX8 mutation rate among congenital hypothyroidism patients
26354716 PAX8 staining is useful for distinguishing between primary thyroid squamous cell carcinoma and invasion or metastasis from extrathyroidal squamous cell carcinoma.
26282166 miR-146b-3p binds to the 3'-untranslated region of PAX8 and sodium/iodide symporter. miR-146b and PAX8 regulate each other and share common target genes.
26258321 Compared with RAS or PAX8/PPARG-positive TCs, BRAFV600E or RET/PTC-positive Thyroid cancers were more often associated with stage III/IV disease and recurrence.
26079312 PAX8 is frequently expressed by ovarian surface epithelial cells, and endogenous levels of PAX8 expression are non-transforming.
26030152 the novel interplay between PAX8 and Neuropilin-2
25827135 PAX8 (mAb) was a specific marker in differentiating primary and extragenital metastatic mucinous ovarian tumours.
25720050 Heterozygous transition in exon 3 of PAX8 gene is associated with hyroid hypoplasia.
More...

AA Sequence

MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGS      1 - 70
IRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPF     71 - 140
NLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDDSDQDSCRLSI    141 - 210
DSQSSSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQGLYPLPLLNSTLDDGKATLTP    211 - 280
SNTPLGRNLSTHQTYPVVADPHSPFAIKQETPEVSSSSSTPSSLSSSAFLDLQQVGSGVPPFNAFPHAAS    281 - 350
VYGQFTGQALLSGREMVGPTLPGYPPHIPTSGQGSYASSAIAGMVAGSEYSGNAYGHTPYSSYSEAWRFP    351 - 420
NSSLLSSPYYYSSTSRPSAPPTTATAFDHL                                            421 - 450
//

Text Mined References (162)

PMID Year Title
26910219 2016 Assessment of the Utility of PAX8 Immunohistochemical Stain in Diagnosing Endocervical Glandular Lesions.
26404914 2016 A subset of solitary fibrous tumors express nuclear PAX8 and PAX2: a potential diagnostic pitfall.
26362610 2015 PAX8 pathogenic variants in Chinese patients with congenital hypothyroidism.
26354716 2015 Diagnostic significance of PAX8 in thyroid squamous cell carcinoma.
26282166 2015 The miR-146b-3p/PAX8/NIS Regulatory Circuit Modulates the Differentiation Phenotype and Function of Thyroid Cells during Carcinogenesis.
26258321 2015 Tumor genotype determines phenotype and disease-related outcomes in thyroid cancer: a study of 1510 patients.
26079312 2015 PAX8 expression in ovarian surface epithelial cells.
26030152 2015 Neuropilin-2 Is a Newly Identified Target of PAX8 in Thyroid Cells.
25827135 2015 Differentiating primary and extragenital metastatic mucinous ovarian tumours: an algorithm combining PAX8 with tumour size and laterality.
25720050 2015 Genetic analysis of the paired box transcription factor (PAX8) gene in a cohort of Polish patients with primary congenital hypothyroidism and dysgenetic thyroid glands.
More...