Property Summary

NCBI Gene PubMed Count 54
Grant Count 48
R01 Count 32
Funding $3,040,509.63
PubMed Score 130.71
PubTator Score 115.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Gene RIF (23)

PMID Text
22742857 TNF is able to upregulate LT-beta expression in hepatic cells at the transcriptional level by the binding of NF-kappaB p50/p65 heterodimers and Ets1 to their respective sites in the LT-beta promoter.
22652080 The multifaceted character of lymphotoxin beta may be involved in inflammatory myopathies and muscular dystrophies.
22294627 A strong association was found between several single nucleotide polymorphisms in the LTA/LTB/TNFalpha locus and Sjogren syndrome.
21248773 Findings provide evidence of additional complexity in the transcriptional regulation of LTB with implications for coordinate expression of genes in this important genomic locus.
21211989 Data show differential expression of interferon-gamma, TNFSF3, TNFSF10, TNFSF12 and PDGFbeta in CD8+, CD14+ and CD4+ cells.
21029472 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20356761 Soluble LTalphabeta in synovial fluid is associated with a proinflammatory cytokine milieu that contributes to synovitis in rheumatoid arthritis.
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MGALGLEGRGGRLQGRGSLLLAVAGATSLVTLLLAVPITVLAVLALVPQDQGGLVTETADPGAQAQQGLG      1 - 70
FQKLPEEEPETDLSPGLPAAHLIGAPLKGQGLGWETTKEQAFLTSGTQFSDAEGLALPQDGLYYLYCLVG     71 - 140
YRGRAPPGGGDPQGRSVTLRSSLYRAGGAYGPGTPELLLEGAETVTPVLDPARRQGYGPLWYTSVGFGGL    141 - 210
VQLRRGERVYVNISHPDMVDFARGKTFFGAVMVG                                        211 - 244
//

Text Mined References (55)

PMID Year Title
26646413 2016 Comparative genomic analysis of eutherian tumor necrosis factor ligand genes.
22742857 2012 TNF-inducible expression of lymphotoxin-? in hepatic cells: an essential role for NF-?B and Ets1 transcription factors.
22652080 2012 The multifaceted character of lymphotoxin ? in inflammatory myopathies and muscular dystrophies.
22294627 2012 Association between genetic variants in the tumour necrosis factor/lymphotoxin ?/lymphotoxin ? locus and primary Sjogren's syndrome in Scandinavian samples.
21248773 2011 Transcriptional repression and DNA looping associated with a novel regulatory element in the final exon of the lymphotoxin-? gene.
21211989 2011 Gene expression profile of cytokines in patients with chronic graft-versus-host disease after allogeneic hematopoietic stem cell transplantation with reduced conditioning.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
21029472 2010 A study of the TNF/LTA/LTB locus and susceptibility to severe malaria in highland papuan children and adults.
20662065 2010 Identification of candidate loci at 6p21 and 21q22 in a genome-wide association study of cardiac manifestations of neonatal lupus.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
More...