Property Summary

NCBI Gene PubMed Count 54
PubMed Score 132.02
PubTator Score 115.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.200 1.8e-03
Atopic dermatitis 1.100 1.0e-02
atypical teratoid / rhabdoid tumor -1.200 8.6e-05
chronic lymphosyte leukemia -1.100 4.0e-04
cutaneous lupus erythematosus 1.800 8.9e-03
glioblastoma -1.300 2.7e-04
interstitial cystitis 2.300 2.7e-03
medulloblastoma, large-cell -1.700 7.4e-05
osteosarcoma -2.628 6.6e-05
primary Sjogren syndrome 2.800 9.5e-05
psoriasis 1.200 6.2e-03
tuberculosis and treatment for 3 months 1.100 7.5e-04
ulcerative colitis 1.300 2.5e-03

Gene RIF (23)

AA Sequence

MGALGLEGRGGRLQGRGSLLLAVAGATSLVTLLLAVPITVLAVLALVPQDQGGLVTETADPGAQAQQGLG      1 - 70
FQKLPEEEPETDLSPGLPAAHLIGAPLKGQGLGWETTKEQAFLTSGTQFSDAEGLALPQDGLYYLYCLVG     71 - 140
YRGRAPPGGGDPQGRSVTLRSSLYRAGGAYGPGTPELLLEGAETVTPVLDPARRQGYGPLWYTSVGFGGL    141 - 210
VQLRRGERVYVNISHPDMVDFARGKTFFGAVMVG                                        211 - 244
//

Text Mined References (55)

PMID Year Title