Property Summary

NCBI Gene PubMed Count 44
Grant Count 28
R01 Count 9
Funding $1,648,987.95
PubMed Score 157.15
PubTator Score 67.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
ependymoma 1.100 0.010
oligodendroglioma 1.200 0.002

Gene RIF (14)

PMID Text
26578590 The polycomb complex proteins BMI1 and RING1A regulate the ubiquitination of chromatin associated proteins bound to promoters.
26141041 On the basis of these results, we proposed that the expression of Ring1 protein may be a novel indicator of hepatocellular carcinoma prognosis.
24711370 HSCARG interacts with RING1 and inhibits RING1 ubiquitination.
24414991 High RING1 expression is associated with non-small cell lung cancer.
21125401 Overexpression of the EZH2, RING1, and BMI1 genes is common in MDS and indicate poor prognosis. The products of these genes might participate in epigenetic regulation of Myelodysplastic syndromes.
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20800574 USP7 was identified as a deubiquitinating enzyme that regulates the ubiquitination state of RING1B.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19851445 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MTTPANAQNASKTWELSLYELHRTPQEAIMDGTEIAVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCS      1 - 70
DCIVTALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSREEYEAHQDRVLIRLSRLHNQQALSSS     71 - 140
IEEGLRMQAMHRAQRVRRPIPGSDQTTTMSGGEGEPGEGEGDGEDVSSDSAPDSAPGPAPKRPRGGGAGG    141 - 210
SSVGTGGGGTGGVGGGAGSEDSGDRGGTLGGGTLGPPSPPGAPSPPEPGGEIELVFRPHPLLVEKGEYCQ    211 - 280
TRYVKTTGNATVDHLSKYLALRIALERRQQQEAGEPGGPGGGASDTGGPDGCGGEGGGAGGGDGPEEPAL    281 - 350
PSLEGVSEKQYTIYIAPGGGAFTTLNGSLTLELVNEKFWKVSRPLELCYAPTKDPK                  351 - 406
//

Text Mined References (53)

PMID Year Title
26578590 2016 RING1A and BMI1 bookmark active genes via ubiquitination of chromatin-associated proteins.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26141041 2015 Upregulated expression of polycomb protein Ring1 contributes to poor prognosis and accelerated proliferation in human hepatocellular carcinoma.
25725044 2015 De novo gain-of-function and loss-of-function mutations of SCN8A in patients with intellectual disabilities and epilepsy.
25416956 2014 A proteome-scale map of the human interactome network.
24711370 2014 HSCARG, a novel regulator of H2A ubiquitination by downregulating PRC1 ubiquitin E3 ligase activity, is essential for cell proliferation.
24414991 2014 Polycomb group oncogene RING1 is over-expressed in non-small cell lung cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23740775 2013 Association of granulomatosis with polyangiitis (Wegener's) with HLA-DPB1*04 and SEMA6A gene variants: evidence from genome-wide analysis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...