Property Summary

NCBI Gene PubMed Count 34
Grant Count 9
R01 Count 8
Funding $410,873.27
PubMed Score 36.23
PubTator Score 37.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Rheumatoid Arthritis 3.300 0.001
malignant mesothelioma 1.200 0.000
cutaneous lupus erythematosus 1.100 0.007
osteosarcoma -1.442 0.000
medulloblastoma 1.600 0.000
atypical teratoid / rhabdoid tumor -2.200 0.000
glioblastoma -2.200 0.000
medulloblastoma, large-cell -2.100 0.013
primitive neuroectodermal tumor 1.500 0.000
tuberculosis -1.100 0.015
adult high grade glioma -1.800 0.009
lung adenocarcinoma -1.500 0.000
inflammatory breast cancer -1.300 0.001
invasive ductal carcinoma 1.300 0.001
ovarian cancer 1.500 0.001

Gene RIF (13)

PMID Text
23856623 The NRF-2beta nuclear localization signal (NLS) is an unusual but is, nevertheless, a bona fide monopartite-type NLS.
23684612 GABP beta is required for YAP expression in vitro and in vivo, and that YAP is an important effector downstream of GABP for cell survival and cell-cycle progression.
21609478 NRF-1 and GABP expression is coordinated by NRF-1's activation of the GABPbeta promoter
21076620 Data show that BRAF knockdown led to suppression of the expression of the GABPbeta, which involved in regulating HPR1 promoter activity.
20028934 Observational study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of GA binding protein transcription factor, beta subunit 1 (GABPB1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18660489 Observational study of gene-disease association. (HuGE Navigator)
18343819 The results are consistent with a pathway whereby PRC regulates NRF-2-dependent genes through a multiprotein complex involving HCF-1.[NRF-2beta]
17726090 serum-responsive GABP binding to Ets-binding sites activates the KIS promoter, leading to KIS gene expression, cell migration, and cell cycle progression
17357964 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSLVDLGKKLLEAARAGQDDEVRILMANGAPFTTDWLGTSPLHLAAQYGHYSTTEVLLRAGVSRDARTKV      1 - 70
DRTPLHMAASEGHASIVEVLLKHGADVNAKDMLKMTALHWATEHNHQEVVELLIKYGADVHTQSKFCKTA     71 - 140
FDISIDNGNEDLAEILQIAMQNQINTNPESPDTVTIHAATPQFIIGPGGVVNLTGLVSSENSSKATDETG    141 - 210
VSAVQFGNSSTSVLATLAALAEASAPLSNSSETPVVATEEVVTAESVDGAIQQVVSSGGQQVITIVTDGI    211 - 280
QLGNLHSIPTSGIGQPIIVTMPDGQQVLTVPATDIAEETVISEEPPAKRQCIEIIENRVESAEIEEREAL    281 - 350
QKQLDEANREAQKYRQQLLKKEQEAEAYRQKLEAMTRLQTNKEAV                             351 - 395
//

Text Mined References (39)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23856623 2013 Nuclear Respiratory Factor 2? (NRF-2?) recruits NRF-2? to the nucleus by binding to importin-?:? via an unusual monopartite-type nuclear localization signal.
23684612 2013 The Ets transcription factor GABP is a component of the hippo pathway essential for growth and antioxidant defense.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21609478 2011 Decreased expression of BRCA1 in SK-BR-3 cells is the result of aberrant activation of the GABP Beta promoter by an NRF-1-containing complex.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
21076620 2010 Induction of heparanase-1 expression by mutant B-Raf kinase: role of GA binding protein in heparanase-1 promoter activation.
20028934 2010 Interaction between SNPs in the NRF2 gene and elite endurance performance.
19060904 2009 An empirical framework for binary interactome mapping.
More...