Property Summary

NCBI Gene PubMed Count 36
PubMed Score 36.70
PubTator Score 37.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.800 9.3e-03
atypical teratoid / rhabdoid tumor -2.200 6.4e-05
cutaneous lupus erythematosus 1.100 7.1e-03
glioblastoma -1.200 2.2e-04
group 3 medulloblastoma 1.500 1.3e-04
inflammatory breast cancer -1.300 6.3e-04
invasive ductal carcinoma 1.300 5.5e-04
lung adenocarcinoma -1.500 8.0e-13
malignant mesothelioma 1.200 1.0e-06
medulloblastoma, large-cell -1.100 2.9e-02
osteosarcoma -1.442 1.3e-05
ovarian cancer 1.500 1.1e-03
primitive neuroectodermal tumor 1.200 1.7e-04
Rheumatoid arthritis 1.100 3.4e-02
tuberculosis -1.100 1.5e-02

Protein-protein Interaction (3)

Gene RIF (15)

AA Sequence

MSLVDLGKKLLEAARAGQDDEVRILMANGAPFTTDWLGTSPLHLAAQYGHYSTTEVLLRAGVSRDARTKV      1 - 70
DRTPLHMAASEGHASIVEVLLKHGADVNAKDMLKMTALHWATEHNHQEVVELLIKYGADVHTQSKFCKTA     71 - 140
FDISIDNGNEDLAEILQIAMQNQINTNPESPDTVTIHAATPQFIIGPGGVVNLTGLVSSENSSKATDETG    141 - 210
VSAVQFGNSSTSVLATLAALAEASAPLSNSSETPVVATEEVVTAESVDGAIQQVVSSGGQQVITIVTDGI    211 - 280
QLGNLHSIPTSGIGQPIIVTMPDGQQVLTVPATDIAEETVISEEPPAKRQCIEIIENRVESAEIEEREAL    281 - 350
QKQLDEANREAQKYRQQLLKKEQEAEAYRQKLEAMTRLQTNKEAV                             351 - 395
//

Text Mined References (41)

PMID Year Title