Property Summary

NCBI Gene PubMed Count 63
PubMed Score 31.69
PubTator Score 61.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma 1.100 1.4e-02
Astrocytoma, Pilocytic 1.200 3.4e-04
atypical teratoid/rhabdoid tumor 1.100 2.2e-04
ependymoma 1.300 1.7e-06
glioblastoma 1.300 4.0e-06
group 4 medulloblastoma 1.600 5.0e-04
ovarian cancer -1.200 1.1e-03

Gene RIF (39)

AA Sequence

MTKREAEELIEIEIDGTEKAECTEESIVEQTYAPAECVSQAIDINEPIGNLKKLLEPRLQCSLDAHEICL      1 - 70
QDIQLDPERSLFDQGVKTDGTVQLSVQVISYQGIEPKLNILEIVKPADTVEVVIDPDAHHAESEAHLVEE     71 - 140
AQVITLDGTKHITTISDETSEQVTRWAAALEGYRKEQERLGIPYDPIQWSTDQVLHWVVWVMKEFSMTDI    141 - 210
DLTTLNISGRELCSLNQEDFFQRVPRGEILWSHLELLRKYVLASQEQQMNEIVTIDQPVQIIPASVQSAT    211 - 280
PTTIKVINSSAKAAKVQRAPRISGEDRSSPGNRTGNNGQIQLWQFLLELLTDKDARDCISWVGDEGEFKL    281 - 350
NQPELVAQKWGQRKNKPTMNYEKLSRALRYYYDGDMICKVQGKRFVYKFVCDLKTLIGYSAAELNRLVTE    351 - 420
CEQKKLAKMQLHGIAQPVTAVALATASLQTEKDN                                        421 - 454
//

Text Mined References (65)

PMID Year Title