Property Summary

NCBI Gene PubMed Count 56
Grant Count 1,145
R01 Count 650
Funding $157,906,382.1
PubMed Score 28.75
PubTator Score 61.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
ependymoma 1.300 0.000
glioblastoma 1.300 0.000
group 4 medulloblastoma 1.600 0.001
pediatric high grade glioma 1.200 0.001
atypical teratoid/rhabdoid tumor 1.100 0.000
pilocytic astrocytoma 1.100 0.000
ovarian cancer -1.200 0.001

Synonym

Accession Q06546 Q12939 GABP subunit alpha
Symbols NFT2
NRF2
NRF2A
E4TF1A
E4TF1-60
RCH04A07

Gene

PANTHER Protein Class (1)

Gene RIF (35)

PMID Text
26553150 ELF1 binding occurs at both TERT promoter mutations in melanoma in vitro such that increased recruitment of GABP is enabled by the spatial architecture of native and novel ETS motifs in the TERT promoter region.
26185160 GABPalpha Binding to Overlapping ETS and CRE DNA Motifs Is Enhanced by CREB1
26170143 study supports the crucial role of GABP in myeloid cell differentiation and identified ITGAM/CD11b as a novel GABP target gene
26109058 The results suggest that NRF-2alpha is a regulator of SIRT3 expression and may shed light on how SIRT3 is upregulated during nutrient stress.
26072332 Expression of the ETS transcription factor GABPalpha is positively correlated to the BCR-ABL1/ABL1 ratio in CML patients and affects imatinib sensitivity in vitro.
25977370 GABPA thus directly links TERT promoter mutations to aberrant expression in multiple cancers.
24481480 GABPA exhibits an increase in binding signal with higher numbers of ETS motifs per promoter. Analysis of the distance between inverted pairs of ETS motifs within promoters and binding by p53, ETS1 and GABPA, shows a coordination of binding for the 3.
24076158 results demonstrate the functional importance of the C/EBPalpha C-terminus beyond the bZIP DNA-binding and dimerization region, which may mediate cooperative activation by C/EBPalpha and GABP of myeloid-specific genes
23856623 When NRF-2alpha and NRF-2beta form a complex, the nuclear import of NRF-2alphabeta becomes strictly dependent on the nuclear localization signal within NRF-2beta.
23684612 GABP alpha is required for YAP expression in vitro and in vivo, and that YAP is an important effector downstream of GABP for cell survival and cell-cycle progression.
More...

AA Sequence

MTKREAEELIEIEIDGTEKAECTEESIVEQTYAPAECVSQAIDINEPIGNLKKLLEPRLQCSLDAHEICL      1 - 70
QDIQLDPERSLFDQGVKTDGTVQLSVQVISYQGIEPKLNILEIVKPADTVEVVIDPDAHHAESEAHLVEE     71 - 140
AQVITLDGTKHITTISDETSEQVTRWAAALEGYRKEQERLGIPYDPIQWSTDQVLHWVVWVMKEFSMTDI    141 - 210
DLTTLNISGRELCSLNQEDFFQRVPRGEILWSHLELLRKYVLASQEQQMNEIVTIDQPVQIIPASVQSAT    211 - 280
PTTIKVINSSAKAAKVQRAPRISGEDRSSPGNRTGNNGQIQLWQFLLELLTDKDARDCISWVGDEGEFKL    281 - 350
NQPELVAQKWGQRKNKPTMNYEKLSRALRYYYDGDMICKVQGKRFVYKFVCDLKTLIGYSAAELNRLVTE    351 - 420
CEQKKLAKMQLHGIAQPVTAVALATASLQTEKDN                                        421 - 454
//

Text Mined References (58)

PMID Year Title
26553150 2016 An interaction proteomics survey of transcription factor binding at recurrent TERT promoter mutations.
26185160 2015 GABP? Binding to Overlapping ETS and CRE DNA Motifs Is Enhanced by CREB1: Custom DNA Microarrays.
26170143 2015 The heteromeric transcription factor GABP activates the ITGAM/CD11b promoter and induces myeloid differentiation.
26109058 2015 Nuclear respiratory factor 2 induces SIRT3 expression.
26072332 2015 Expression of the ETS transcription factor GABP? is positively correlated to the BCR-ABL1/ABL1 ratio in CML patients and affects imatinib sensitivity in vitro.
25977370 2015 Cancer. The transcription factor GABP selectively binds and activates the mutant TERT promoter in cancer.
24481480 2014 Preferred binding of gain-of-function mutant p53 to bidirectional promoters with coordinated binding of ETS1 and GABPA to multiple binding sites.
24076158 2013 Identification of the C/EBP? C-terminal tail residues involved in the protein interaction with GABP and their potency in myeloid differentiation of K562 cells.
23856623 2013 Nuclear Respiratory Factor 2? (NRF-2?) recruits NRF-2? to the nucleus by binding to importin-?:? via an unusual monopartite-type nuclear localization signal.
23684612 2013 The Ets transcription factor GABP is a component of the hippo pathway essential for growth and antioxidant defense.
More...