Property Summary

NCBI Gene PubMed Count 72
PubMed Score 1727.72
PubTator Score 1161.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
gastric carcinoma -3.600 8.7e-03
interstitial cystitis -2.200 1.3e-03
pancreatic ductal adenocarcinoma liver m... -4.104 6.3e-03

Gene RIF (41)

AA Sequence

MSDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVP      1 - 70
IWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFI     71 - 140
KKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEE    141 - 210
LNLILKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRE    211 - 280
LFPWE                                                                     281 - 285
//

Text Mined References (75)

PMID Year Title