Property Summary

NCBI Gene PubMed Count 71
Grant Count 284
R01 Count 175
Funding $50,849,296.15
PubMed Score 1662.67
PubTator Score 1161.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -4.104 0.006
interstitial cystitis -2.300 0.000
gastric carcinoma -3.600 0.009

Synonym

Accession Q06520
Symbols HST
ST2
STD
hSTa
DHEAS
ST2A1
ST2A3
DHEA-ST

Gene

PANTHER Protein Class (1)

PDB

1EFH   1J99   1OV4   2QP3   2QP4   3F3Y   4IFB  

Gene RIF (41)

PMID Text
26680489 Decreased SULT2A1 activity was found in the adrenal zona reticularis in Alzheimer's disease patients.
26504856 PSC is characterized by disease-specific impairment of SULT2A1 expression following PXR activation, a phenomenon which is not noted in PBC, and may account for the impaired hepatoprotection in PSC.
26169578 It metabolizes breast cancer drugs like afinoxifene and endoxifen by sulfation.
26149755 The substrate, such as lithocholic acid (LCA), participated in regulating the structure and flexibility of sulfotransferase actively rather than merely being selected passively.
25802089 Our results show that SULT2A1 is important in the first trimester; particularly in the adrenals
25750022 molecular dynamic simulations were used to investigate the effect of ligands (cofactor and substrate) on the thermo-denaturation process of hSULT2A1
25065588 It turns out the protective effect of DHEA was significantly decreased when Wnt/beta-catenin signaling was activated, while inactivating Wnt/beta-catenin signaling enhanced the effects of DHEA
25056952 The complete kinetic mechanism of human SULT2A1.
25028566 results established human SULT2A1 as a novel LXRalpha target gene; the expression of LXRalpha is a potential predictor for the expression of SULT2A1 in human liver
23861462 Genetic variants in SULT2A1 do not predispose to polycystic ovary syndrome. Although a variant in SULT2A1 decreased the DHEAS to DHEA ratio, no changes in other androgenic hormone levels were observed.
More...

AA Sequence

MSDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVP      1 - 70
IWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFI     71 - 140
KKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEE    141 - 210
LNLILKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRE    211 - 280
LFPWE                                                                     281 - 285
//

Text Mined References (74)

PMID Year Title
26680489 2015 Reduced sulfotransferase SULT2A1 activity in patients with Alzheimer's disease.
26504856 2015 Liver Expression of Sulphotransferase 2A1 Enzyme Is Impaired in Patients with Primary Sclerosing Cholangitis: Lack of the Response to Enhanced Expression of PXR.
26169578 2015 Sulfation of afimoxifene, endoxifen, raloxifene, and fulvestrant by the human cytosolic sulfotransferases (SULTs): A systematic analysis.
26149755 2015 The impact of ligands on the structure and flexibility of sulfotransferases: a molecular dynamics simulation study.
25802089 2015 Genetic variation, expression and ontogeny of sulfotransferase SULT2A1 in humans.
25750022 2015 The effect of ligands on the thermal stability of sulfotransferases: a molecular dynamics simulation study.
25416956 2014 A proteome-scale map of the human interactome network.
25065588 2014 A possible mechanism in DHEA-mediated protection against osteoarthritis.
25056952 2014 Paradigms of sulfotransferase catalysis: the mechanism of SULT2A1.
25028566 2014 Transcriptional regulation of human hydroxysteroid sulfotransferase SULT2A1 by LXR?.
More...