Property Summary

NCBI Gene PubMed Count 62
Grant Count 74
R01 Count 23
Funding $9,322,116.95
PubMed Score 137.29
PubTator Score 84.14

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q06481 B3KXX9 H7BXI4 Q13861 Q14594 Q14662 Q71U10 Q7M4L3 Q9BT36 APLP-2
Symbols APPH
APPL2
CDEBP
APLP-2

Gene

Gene RIF (28)

PMID Text
26313004 This paper demonstrates an important role for APLP2 in refractive development in mice and humans, suggesting a high level of evolutionary conservation of the signaling pathways underlying refractive eye development.
26085104 We conclude that PCSK9 enhances the degradation of the LDLR independently of either APLP2 or sortilin both ex vivo and in mice.
25683482 APLP1 and APLP2, behave similarly to APP in that they both associate with assembled NMDA receptors in the endoplasmic reticulum
25576918 Data show that amyloid precursor-like protein 2 (APLP2) expression is elevated in pancreatic cancer metastases.
23430252 amyloid precursor protein-like protein-2, but not amyloid precursor protein, is involved in mediating postendocytic delivery of PCSK9 to lysosomes and is therefore important for PCSK9 function
22797723 our discoveries establish a role for APLP2 in the growth of pancreatic cancer cells and show that inhibitors preventing APLP2 cleavage reduce the viability of pancreatic cancer cells.
22641691 Aberrant enhancement of YWK-II/APLP2 by nuclear export of Bat3 may play a role in cancer development by inhibiting cell apoptosis.
21952790 APP and its mammalian homologs, amyloid precursor-like proteins APLP1 and APLP2, participate under physiological conditions via trans-cellular dimerization in synaptogenesis.
21826533 Regulation of major histocompatibility complex class I molecule expression on cancer cells by amyloid precursor-like protein 2.
21695060 proteolytic cleavage sites of the amyloid precursor-like protein 2 by the proteases ADAM10, BACE1 and gamma-secretase
More...

AA Sequence

MAATGTAAAAATGRLLLLLLVGLTAPALALAGYIEALAANAGTGFAVAEPQIAMFCGKLNMHVNIQTGKW      1 - 70
EPDPTGTKSCFETKEEVLQYCQEMYPELQITNVMEANQRVSIDNWCRRDKKQCKSRFVTPFKCLVGEFVS     71 - 140
DVLLVPEKCQFFHKERMEVCENHQHWHTVVKEACLTQGMTLYSYGMLLPCGVDQFHGTEYVCCPQTKIIG    141 - 210
SVSKEEEEEDEEEEEEEDEEEDYDVYKSEFPTEADLEDFTEAAVDEDDEDEEEGEEVVEDRDYYYDTFKG    211 - 280
DDYNEENPTEPGSDGTMSDKEITHDVKAVCSQEAMTGPCRAVMPRWYFDLSKGKCVRFIYGGCGGNRNNF    281 - 350
ESEDYCMAVCKAMIPPTPLPTNDVDVYFETSADDNEHARFQKAKEQLEIRHRNRMDRVKKEWEEAELQAK    351 - 420
NLPKAERQTLIQHFQAMVKALEKEAASEKQQLVETHLARVEAMLNDRRRMALENYLAALQSDPPRPHRIL    421 - 490
QALRRYVRAENKDRLHTIRHYQHVLAVDPEKAAQMKSQVMTHLHVIEERRNQSLSLLYKVPYVAQEIQEE    491 - 560
IDELLQEQRADMDQFTASISETPVDVRVSSEESEEIPPFHPFHPFPALPENEDTQPELYHPMKKGSGVGE    561 - 630
QDGGLIGAEEKVINSKNKVDENMVIDETLDVKEMIFNAERVGGLEEERESVGPLREDFSLSSSALIGLLV    631 - 700
IAVAIATVIVISLVMLRKRQYGTISHGIVEVDPMLTPEERHLNKMQNHGYENPTYKYLEQMQI           701 - 763
//

Text Mined References (69)

PMID Year Title
26313004 2015 APLP2 Regulates Refractive Error and Myopia Development in Mice and Humans.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
26085104 2015 Amyloid Precursor-like Protein 2 and Sortilin Do Not Regulate the PCSK9 Convertase-mediated Low Density Lipoprotein Receptor Degradation but Interact with Each Other.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25683482 2015 APLP1 and APLP2, members of the APP family of proteins, behave similarly to APP in that they associate with NMDA receptors and enhance NMDA receptor surface expression.
25576918 2015 Amyloid precursor-like protein 2 (APLP2) affects the actin cytoskeleton and increases pancreatic cancer growth and metastasis.
23430252 2013 Characterization of proprotein convertase subtilisin/kexin type 9 (PCSK9) trafficking reveals a novel lysosomal targeting mechanism via amyloid precursor-like protein 2 (APLP2).
22797723 2012 Relevance of amyloid precursor-like protein 2 C-terminal fragments in pancreatic cancer cells.
22641691 2012 Regulation of apoptosis by Bat3-enhanced YWK-II/APLP2 protein stability.
21952790 2012 Structural aspects and physiological consequences of APP/APLP trans-dimerization.
More...