Property Summary

NCBI Gene PubMed Count 136
PubMed Score 689.50
PubTator Score 473.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (30)

Disease log2 FC p
adult high grade glioma -2.200 4.5e-04
astrocytic glioma -1.700 1.4e-02
Astrocytoma, Pilocytic -1.400 2.0e-03
Atopic dermatitis -1.300 1.7e-03
atypical teratoid / rhabdoid tumor -2.100 2.4e-02
Breast cancer -1.300 4.0e-05
breast carcinoma -1.800 1.4e-05
colon cancer -1.700 1.7e-02
ductal carcinoma in situ -1.200 1.6e-02
ependymoma -2.500 5.1e-03
glioblastoma -2.200 4.5e-07
intraductal papillary-mucinous adenoma (... -1.300 1.8e-02
intraductal papillary-mucinous carcinoma... -1.400 1.2e-02
intraductal papillary-mucinous neoplasm ... -1.500 4.5e-02
invasive ductal carcinoma -1.209 3.4e-03
juvenile dermatomyositis 1.050 1.7e-09
lung adenocarcinoma -1.300 1.8e-12
lung cancer -2.700 4.7e-04
malignant mesothelioma -4.100 9.7e-10
medulloblastoma -1.700 3.3e-02
medulloblastoma, large-cell -1.300 5.2e-03
non-small cell lung cancer -1.006 3.0e-07
oligodendroglioma -1.800 7.4e-03
osteosarcoma 2.710 8.1e-04
ovarian cancer -3.200 3.4e-16
pancreatic cancer 1.100 1.1e-02
pituitary cancer 1.500 5.1e-05
primary pancreatic ductal adenocarcinoma 1.142 2.2e-02
psoriasis -1.700 1.0e-05
subependymal giant cell astrocytoma -2.468 2.7e-02

Gene RIF (95)

AA Sequence

MISVKRNTWRALSLVIGDCRKKGNFEYCQDRTEKHSTMPDSPVDVKTQSRLTPPTMPPPPTTQGAPRTSS      1 - 70
FTPTTLTNGTSHSPTALNGAPSPPNGFSNGPSSSSSSSLANQQLPPACGARQLSKLKRFLTTLQQFGNDI     71 - 140
SPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARLAKQNPAQY    141 - 210
LAQHEQLLLDASTTSPVDSSELLLDVNENGKRRTPDRTKENGFDREPLHSEHPSKRPCTISPGQRYSPNN    211 - 280
GLSYQPNGLPHPTPPPPQHYRLDDMAIAHHYRDSYRHPSHRDLRDRNRPMGLHGTRQEEMIDHRLTDREW    281 - 350
AEEWKHLDHLLNCIMDMVEKTRRSLTVLRRCQEADREELNYWIRRYSDAEDLKKGGGSSSSHSRQQSPVN    351 - 420
PDPVALDAHREFLHRPASGYVPEEIWKKAEEAVNEVKRQAMTELQKAVSEAERKAHDMITTERAKMERTV    421 - 490
AEAKRQAAEDALAVINQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHICGQTLQAQQQ    491 - 560
GDTPAVSSSVTPNSGAGSPMDTPPAATPRSTTPGTPSTIETTPR                              561 - 604
//

Text Mined References (147)

PMID Year Title