Property Summary

NCBI Gene PubMed Count 127
PubMed Score 604.34
PubTator Score 473.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
ovarian cancer 8492 3.00999312131314E-10
non-small cell lung cancer 2798 4.07264089150065E-10
malignant mesothelioma 3163 9.67218655186486E-10
juvenile dermatomyositis 1189 1.6739156461907E-9
lung adenocarcinoma 2714 9.64229082396066E-7
glioblastoma 5572 3.03970635519427E-6
pituitary cancer 1972 3.85034195876552E-6
breast carcinoma 1614 1.40692024929051E-5
lung cancer 4473 1.71788568059677E-5
pediatric high grade glioma 2712 4.24493756764835E-5
medulloblastoma 1524 1.189359742355E-4
invasive ductal carcinoma 2950 1.66297763192646E-4
pilocytic astrocytoma 3086 2.23900687972401E-4
psoriasis 6685 2.8473857642778E-4
osteosarcoma 7933 8.14059448880971E-4
Atopic dermatitis 944 0.00169821371525494
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00297579777009759
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00496794154440418
ependymoma 2514 0.00505199821653023
medulloblastoma, large-cell 6234 0.00518332518497722
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0065294125307223
oligodendroglioma 2849 0.00742119748217982
atypical teratoid / rhabdoid tumor 4369 0.00973438124557649
pancreatic cancer 2300 0.0105152148212021
astrocytic glioma 2241 0.0144823298746672
ductal carcinoma in situ 1745 0.0158403115811715
colon cancer 1475 0.0168214177266537
non-inflammatory breast cancer 208 0.0219283890564932
primary pancreatic ductal adenocarcinoma 1271 0.0221394500861883
subependymal giant cell astrocytoma 2287 0.0330293739646147
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2346 0.0 4.0
Disease Target Count Z-score Confidence
Leukemia 88 5.454 2.7
Myeloid sarcoma 4 3.432 1.7
Mucoepidermoid carcinoma 19 3.062 1.5

Expression

Synonym

Accession Q06455 B7Z4P4 E7EPN4 O14784 Q06456 Q14873 Q16239 Q16346 Q16347 Q6IBL1 Q6NXH1 Q7Z4J5 Q92479 Q9BRZ0
Symbols CDR
ETO
MTG8
AML1T1
ZMYND2
CBFA2T1
AML1-MTG8

Gene

PDB

2ODD   2KYG   1WQ6   2DJ8   2H7B   2KNH   2OD1   2PP4   4JOL  

  Ortholog (11)

Gene RIF (87)

PMID Text
26706127 Data suggest that biosynthesis and folding of leukemogenic fusion oncoprotein AML1-ETO/RUNX1-RUNX1T1 is facilitated by interaction with the chaperonin TRiC/CCT1/TCP1 and HSP70 (heat shock protein 70).
26546158 AML1/ETO transactivates gene expression through recruiting AP-1 to the AML1/ETO-AML1 complex.
26320575 Exon splicing patterns in the human RUNX1-RUNX1T1 fusion gene present in acute myeloid leukemia patients have been decoded.
25928846 A substantial fraction of AML1-ETO/p300 co-localization occurs near TSSs in promoter regions associated with transcriptionally active loci.
25101977 In t(8;21) acute myelogenous leukemia (AML), the acquisition of AML1/ETO is not sufficient, and the subsequent upregulation of AML1/ETO and the additional c-KIT mutant signaling are critical steps for transformation into leukemic stem cells.
25082877 minimal residual disease determined by RUNX1/RUNX1T1 transcript levels could identify allogeneic hematopoietic stem cell transplantation t(8;21) (q22;q22) acute myeloid leukemia patients who are at high risk for relapse, together with c-KIT mutations
24976338 RUNX1T1 gene may participate in t(8;21)(q22;q22)-dependent leukemic transformation due to its multiple interactions in cell regulatory network particularly through synergistic or antagonistic effects in relation to activity of RUNX1-RUNX1T1 fusion gene.
24973361 identify a high-frequency mutation in t(8;21)/RUNX1-RUNX1T1 acute myekoid leukemia (AML) and identify the need for future studies to investigate the clinical and biological relevance of ASXL2 mutations in this unique subset of AML
24897507 RUNX1/ETO-induced DNA damage and apoptosis in human primary CD34+ hematopoietic progenitors are rescued by activating c-Kit mutations
24783204 Our data shows that upregulated of the RUNX1-RUNX1T1 gene set maybe an important factor contributing to the etiology of ccRCC.
More...

AA Sequence

MISVKRNTWRALSLVIGDCRKKGNFEYCQDRTEKHSTMPDSPVDVKTQSRLTPPTMPPPPTTQGAPRTSS      1 - 70
FTPTTLTNGTSHSPTALNGAPSPPNGFSNGPSSSSSSSLANQQLPPACGARQLSKLKRFLTTLQQFGNDI     71 - 140
SPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARLAKQNPAQY    141 - 210
LAQHEQLLLDASTTSPVDSSELLLDVNENGKRRTPDRTKENGFDREPLHSEHPSKRPCTISPGQRYSPNN    211 - 280
GLSYQPNGLPHPTPPPPQHYRLDDMAIAHHYRDSYRHPSHRDLRDRNRPMGLHGTRQEEMIDHRLTDREW    281 - 350
AEEWKHLDHLLNCIMDMVEKTRRSLTVLRRCQEADREELNYWIRRYSDAEDLKKGGGSSSSHSRQQSPVN    351 - 420
PDPVALDAHREFLHRPASGYVPEEIWKKAEEAVNEVKRQAMTELQKAVSEAERKAHDMITTERAKMERTV    421 - 490
AEAKRQAAEDALAVINQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHICGQTLQAQQQ    491 - 560
GDTPAVSSSVTPNSGAGSPMDTPPAATPRSTTPGTPSTIETTPR                              561 - 604
//

Text Mined References (139)

PMID Year Title
26706127 2016 Chaperonin TRiC/CCT Modulates the Folding and Activity of Leukemogenic Fusion Oncoprotein AML1-ETO.
26546158 2016 Genome-wide studies identify a novel interplay between AML1 and AML1/ETO in t(8;21) acute myeloid leukemia.
26320575 2015 Decoding of exon splicing patterns in the human RUNX1-RUNX1T1 fusion gene.
25928846 2015 Genome-wide co-occupancy of AML1-ETO and N-CoR defines the t(8;21) AML signature in leukemic cells.
25416956 2014 A proteome-scale map of the human interactome network.
25101977 2014 The ordered acquisition of Class II and Class I mutations directs formation of human t(8;21) acute myelogenous leukemia stem cell.
25082877 2014 In adults with t(8;21)AML, posttransplant RUNX1/RUNX1T1-based MRD monitoring, rather than c-KIT mutations, allows further risk stratification.
24976338 2014 RUNX1T1/MTG8/ETO gene expression status in human t(8;21)(q22;q22)-positive acute myeloid leukemia cells.
24973361 2014 Frequent ASXL2 mutations in acute myeloid leukemia patients with t(8;21)/RUNX1-RUNX1T1 chromosomal translocations.
24897507 2015 Activating c-KIT mutations confer oncogenic cooperativity and rescue RUNX1/ETO-induced DNA damage and apoptosis in human primary CD34+ hematopoietic progenitors.
More...