Property Summary

NCBI Gene PubMed Count 13
PubMed Score 5.29
PubTator Score 8.45

Knowledge Summary

Patent (308)

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 4.7e-04
psoriasis 6694 2.9e-02
Disease Target Count Z-score Confidence
Malignant hyperthermia 26 4.089 2.0

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.019 4.7e-04
psoriasis -1.100 2.9e-02

 MGI Phenotype (1)

Gene RIF (1)

AA Sequence

MSQTKMLKVRVTLFCILAGIVLAMTAVVTDHWAVLSPHMEHHNTTCEAAHFGLWRICTKRIPMDDSKTCG      1 - 70
PITLPGEKNCSYFRHFNPGESSEIFEFTTQKEYSISAAAIAIFSLGFIILGSLCVLLSLGKKRDYLLRPA     71 - 140
SMFYAFAGLCILVSVEVMRQSVKRMIDSEDTVWIEYYYSWSFACACAAFILLFLGGLALLLFSLPRMPRN    141 - 210
PWESCMDAEPEH                                                              211 - 222
//

Text Mined References (14)

PMID Year Title