Property Summary

NCBI Gene PubMed Count 13
PubMed Score 4.54
PubTator Score 8.45

Knowledge Summary

Patent (308)

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 4.74968011308486E-4
psoriasis 6685 0.0293781455983016
Disease Target Count Z-score Confidence
Malignant hyperthermia 25 4.05 2.0

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.019 0.000
psoriasis -1.100 0.029

Synonym

Accession Q06432 B2R9N3 Q14D59
Symbols CACNLG

Gene

  Ortholog (12)

 MGI Term (1)

Gene RIF (1)

PMID Text
18187620 Knockdown of calcium channel, voltage-dependent, gamma subunit 1 (CACNG1) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MSQTKMLKVRVTLFCILAGIVLAMTAVVTDHWAVLSPHMEHHNTTCEAAHFGLWRICTKRIPMDDSKTCG      1 - 70
PITLPGEKNCSYFRHFNPGESSEIFEFTTQKEYSISAAAIAIFSLGFIILGSLCVLLSLGKKRDYLLRPA     71 - 140
SMFYAFAGLCILVSVEVMRQSVKRMIDSEDTVWIEYYYSWSFACACAAFILLFLGGLALLLFSLPRMPRN    141 - 210
PWESCMDAEPEH                                                              211 - 222
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
17652770 2007 Calcium channel gamma subunits: a functionally diverse protein family.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11738816 2001 Calcium channel gamma subunits provide insights into the evolution of this gene family.
11170751 2001 A cluster of three novel Ca2+ channel gamma subunit genes on chromosome 19q13.4: evolution and expression profile of the gamma subunit gene family.
10613843 1999 Identification of three novel Ca(2+) channel gamma subunit genes reveals molecular diversification by tandem and chromosome duplication.
9186513 1997 A somatic cell hybrid panel for distal 17q: GDIA1 maps to 17q25.3.
More...