Property Summary

NCBI Gene PubMed Count 13
Grant Count 5
R01 Count 5
Funding $266,818.35
PubMed Score 4.54
PubTator Score 8.45

Knowledge Summary

Patent (308)

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.019 0.000
psoriasis -1.100 0.029

 MGI Term (1)

Gene RIF (1)

PMID Text
18187620 Knockdown of calcium channel, voltage-dependent, gamma subunit 1 (CACNG1) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MSQTKMLKVRVTLFCILAGIVLAMTAVVTDHWAVLSPHMEHHNTTCEAAHFGLWRICTKRIPMDDSKTCG      1 - 70
PITLPGEKNCSYFRHFNPGESSEIFEFTTQKEYSISAAAIAIFSLGFIILGSLCVLLSLGKKRDYLLRPA     71 - 140
SMFYAFAGLCILVSVEVMRQSVKRMIDSEDTVWIEYYYSWSFACACAAFILLFLGGLALLLFSLPRMPRN    141 - 210
PWESCMDAEPEH                                                              211 - 222
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
17652770 2007 Calcium channel gamma subunits: a functionally diverse protein family.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11738816 2001 Calcium channel gamma subunits provide insights into the evolution of this gene family.
11170751 2001 A cluster of three novel Ca2+ channel gamma subunit genes on chromosome 19q13.4: evolution and expression profile of the gamma subunit gene family.
10613843 1999 Identification of three novel Ca(2+) channel gamma subunit genes reveals molecular diversification by tandem and chromosome duplication.
9186513 1997 A somatic cell hybrid panel for distal 17q: GDIA1 maps to 17q25.3.
More...