Property Summary

NCBI Gene PubMed Count 49
Grant Count 104
R01 Count 58
Funding $14,465,640.56
PubMed Score 790.10
PubTator Score 104.95

Knowledge Summary

Patent (290,837)

Expression

  Differential Expression (14)

Disease log2 FC p
esophageal adenocarcinoma -1.100 0.023
psoriasis 1.400 0.000
osteosarcoma 2.187 0.000
ependymoma -1.100 0.000
group 3 medulloblastoma -2.800 0.000
atypical teratoid / rhabdoid tumor -2.000 0.000
medulloblastoma, large-cell -2.700 0.000
primitive neuroectodermal tumor -1.300 0.018
breast carcinoma -1.500 0.001
fibroadenoma -2.000 0.015
adult high grade glioma -1.200 0.016
subependymal giant cell astrocytoma -1.246 0.035
ductal carcinoma in situ -1.800 0.001
invasive ductal carcinoma -1.900 0.010

Synonym

Accession Q06418 O14953 Q86VR3
Symbols BYK
Dtk
RSE
Rek
Sky
Tif
Etk-2

Gene

PDB

1RHF  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (31)

PMID Text
27034374 genetic ablation of a receptor tyrosine kinase encoded byTyro3in mice or the functional neutralization of its ortholog in human dendritic cells resulted in enhanced type 2 immunity.
26656104 Tyro3 gene dosage modulates Mertk-associated retinal degeneration, provide strong evidence for a direct role for TYRO3 in RPE phagocytosis, and suggest that an eQTL can modify a recessive Inherited photoreceptor degenerations.
26573872 these data suggest that Tyro3 contributes significantly to tumor growth, aggressiveness and liver dysfunction
25881761 The mRNA expression levels of Tyro-3, Axl were decreased in pSS patients. When considering the plasma level, increased levels of soluble Mer was observed with statistically significant difference.
25878564 Significantly increased levels of sMer, sTyro3 and sAxl may be important factors contributing to the deficit in phagocytosis ability in systemic lupus erythematosus .
25815442 the results of the present study demonstrated that the acquired taxol resistance of ovarian cancer cells was associated with ROS-dependent upregulation in the expression of Tyro3 RTK and the subsequent activation of Akt.
25211072 Tetherin phosphorylation induces the recruitment of Syk which is required for downstream NF-kappaB activation.
25074926 These studies demonstrate that, despite their similarity, TYRO3, AXL, and MER are likely to perform distinct functions in both immunoregulation and the recognition and removal of ACs.
24982338 The effects of TYRO3-knockdown by small interfering RNA (siRNA) on proliferation, cell-cycle distribution, and cell signaling in different breast neoplasm cell lines were compared.
23865365 Low expression of the Syk gene may play an important role in tumorigenesis in esophageal cancer.
More...

AA Sequence

MALRRSMGRPGLPPLPLPPPPRLGLLLAALASLLLPESAAAGLKLMGAPVKLTVSQGQPVKLNCSVEGME      1 - 70
EPDIQWVKDGAVVQNLDQLYIPVSEQHWIGFLSLKSVERSDAGRYWCQVEDGGETEISQPVWLTVEGVPF     71 - 140
FTVEPKDLAVPPNAPFQLSCEAVGPPEPVTIVWWRGTTKIGGPAPSPSVLNVTGVTQSTMFSCEAHNLKG    141 - 210
LASSRTATVHLQALPAAPFNITVTKLSSSNASVAWMPGADGRALLQSCTVQVTQAPGGWEVLAVVVPVPP    211 - 280
FTCLLRDLVPATNYSLRVRCANALGPSPYADWVPFQTKGLAPASAPQNLHAIRTDSGLILEWEEVIPEAP    281 - 350
LEGPLGPYKLSWVQDNGTQDELTVEGTRANLTGWDPQKDLIVRVCVSNAVGCGPWSQPLVVSSHDRAGQQ    351 - 420
GPPHSRTSWVPVVLGVLTALVTAAALALILLRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPER    421 - 490
IEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASS    491 - 560
DIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQ    561 - 630
TLIRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLA    631 - 700
LESLADNLYTVQSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEDVYDLMYQCWS    701 - 770
ADPKQRPSFTCLRMELENILGQLSVLSASQDPLYINIERAEEPTAGGSLELPGRDQPYSGAGDGSGMGAV    771 - 840
GGTPSDCRYILTPGGLAEQPGQAEHQPESPLNETQRLLLLQQGLLPHSSC                        841 - 890
//

Text Mined References (55)

PMID Year Title
27034374 2016 The TAM family receptor tyrosine kinase TYRO3 is a negative regulator of type 2 immunity.
26656104 2015 Tyro3 Modulates Mertk-Associated Retinal Degeneration.
26573872 2016 Overexpression of Tyro3 and its implications on hepatocellular carcinoma progression.
25881761 2015 The association of Tyro3/Axl/Mer signaling with inflammatory response, disease activity in patients with primary Sjögren's syndrome.
25878564 2015 Increased soluble phagocytic receptors sMer, sTyro3 and sAxl and reduced phagocytosis in juvenile-onset systemic lupus erythematosus.
25815442 2015 Overexpression of Tyro3 receptor tyrosine kinase leads to the acquisition of taxol resistance in ovarian cancer cells.
25416956 2014 A proteome-scale map of the human interactome network.
25277499 2014 Phosphatidylserine receptors: enhancers of enveloped virus entry and infection.
25211072 2014 Retroviral retention activates a Syk-dependent HemITAM in human tetherin.
25074926 2014 Receptor tyrosine kinases, TYRO3, AXL, and MER, demonstrate distinct patterns and complex regulation of ligand-induced activation.
More...