Property Summary

Ligand Count 24
NCBI Gene PubMed Count 54
PubMed Score 867.20
PubTator Score 104.95

Knowledge Summary

Patent (290,837)

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.200 1.6e-02
atypical teratoid / rhabdoid tumor -1.600 1.5e-05
breast carcinoma -1.300 3.2e-03
ductal carcinoma in situ -1.800 9.9e-04
ependymoma -1.100 1.9e-04
esophageal adenocarcinoma -1.100 2.3e-02
fibroadenoma -2.000 1.5e-02
group 3 medulloblastoma -2.100 1.4e-03
invasive ductal carcinoma -1.900 1.0e-02
medulloblastoma, large-cell -2.000 4.7e-06
osteosarcoma 1.130 3.2e-04
primitive neuroectodermal tumor -1.200 1.5e-02
psoriasis 1.400 7.2e-05
subependymal giant cell astrocytoma -1.246 3.5e-02

Gene RIF (37)

AA Sequence

MALRRSMGRPGLPPLPLPPPPRLGLLLAALASLLLPESAAAGLKLMGAPVKLTVSQGQPVKLNCSVEGME      1 - 70
EPDIQWVKDGAVVQNLDQLYIPVSEQHWIGFLSLKSVERSDAGRYWCQVEDGGETEISQPVWLTVEGVPF     71 - 140
FTVEPKDLAVPPNAPFQLSCEAVGPPEPVTIVWWRGTTKIGGPAPSPSVLNVTGVTQSTMFSCEAHNLKG    141 - 210
LASSRTATVHLQALPAAPFNITVTKLSSSNASVAWMPGADGRALLQSCTVQVTQAPGGWEVLAVVVPVPP    211 - 280
FTCLLRDLVPATNYSLRVRCANALGPSPYADWVPFQTKGLAPASAPQNLHAIRTDSGLILEWEEVIPEAP    281 - 350
LEGPLGPYKLSWVQDNGTQDELTVEGTRANLTGWDPQKDLIVRVCVSNAVGCGPWSQPLVVSSHDRAGQQ    351 - 420
GPPHSRTSWVPVVLGVLTALVTAAALALILLRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPER    421 - 490
IEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASS    491 - 560
DIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQ    561 - 630
TLIRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLA    631 - 700
LESLADNLYTVQSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEDVYDLMYQCWS    701 - 770
ADPKQRPSFTCLRMELENILGQLSVLSASQDPLYINIERAEEPTAGGSLELPGRDQPYSGAGDGSGMGAV    771 - 840
GGTPSDCRYILTPGGLAEQPGQAEHQPESPLNETQRLLLLQQGLLPHSSC                        841 - 890
//

Text Mined References (60)

PMID Year Title