Property Summary

NCBI Gene PubMed Count 143
PubMed Score 184.53
PubTator Score 146.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.2
Kidney cancer 2613 0.0 0.6

Expression

  Differential Expression (31)

Disease log2 FC p
lung cancer -2.500 1.6e-05
active Crohn's disease -1.002 2.2e-02
active ulcerative colitis -2.546 1.9e-03
adult high grade glioma -2.100 3.4e-02
astrocytic glioma -1.700 1.2e-03
Astrocytoma, Pilocytic -1.200 3.9e-02
atypical teratoid / rhabdoid tumor -1.300 1.2e-03
Breast cancer -1.300 1.4e-07
colon cancer -1.700 8.7e-03
dermatomyositis -1.700 1.8e-03
ependymoma -2.500 1.1e-03
gastric cancer -1.100 2.0e-02
glioblastoma -1.200 1.0e-02
group 3 medulloblastoma -2.400 1.8e-02
intraductal papillary-mucinous carcinoma... -2.600 1.3e-03
intraductal papillary-mucinous neoplasm ... -2.200 1.1e-02
invasive ductal carcinoma -1.200 1.8e-03
malignant mesothelioma -2.000 3.5e-05
medulloblastoma, large-cell -3.700 5.0e-04
nasopharyngeal carcinoma -1.400 3.2e-03
nephrosclerosis 1.229 1.2e-03
non-small cell lung cancer -1.088 2.7e-09
oligodendroglioma -1.600 1.7e-02
osteosarcoma 1.541 8.5e-03
ovarian cancer -2.500 4.8e-09
Parkinson's disease -1.200 2.8e-02
periodontitis 1.100 5.3e-27
primary Sjogren syndrome 2.100 2.7e-05
primitive neuroectodermal tumor -1.300 4.3e-02
psoriasis -2.000 2.4e-04
Waldenstrons macroglobulinemia -1.046 1.8e-02

Protein-protein Interaction (1)

Gene RIF (86)

AA Sequence

MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYASTDMDKVLLKYT      1 - 70
EYNEPHESRTNSDIVETLRKKGLNGCDSPDPDADDSVGHSPESEDKYRKINEDIDLMISRQRLCAVPPPN     71 - 140
FEMPVSIPVSSHNSLVYSNPVSSLGNPNLLPLAHPSLQRNSMSPGVTHRPPSAGNTGGLMGGDLTSGAGT    141 - 210
SAGNGYGNPRNSPGLLVSPGNLNKNMQAKSPPPMNLGMNNRKPDLRVLIPPGSKNTMPSVSEDVDLLLNQ    211 - 280
RINNSQSAQSLATPVVSVATPTLPGQGMGGYPSAISTTYGTEYSLSSADLSSLSGFNTASALHLGSVTGW    281 - 350
QQQHLHNMPPSALSQLGACTSTHLSQSSNLSLPSTQSLNIKSEPVSPPRDRTTTPSRYPQHTRHEAGRSP    351 - 420
VDSLSSCSSSYDGSDREDHRNEFHSPIGLTRPSPDERESPSVKRMRLSEGWAT                     421 - 473
//

Text Mined References (151)

PMID Year Title