Property Summary

NCBI Gene PubMed Count 109
Grant Count 294
R01 Count 182
Funding $35,969,637.14
PubMed Score 424.99
PubTator Score 275.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Synonym

Accession Q06330 B4DY22 Q5XKH9 Q6P1N3
Symbols SUH
csl
AOS3
CBF1
KBF2
RBP-J
RBPJK
IGKJRB
RBPSUH
IGKJRB1

Gene

PANTHER Protein Class (1)

PDB

2F8X   3NBN   3V79  

Gene RIF (71)

PMID Text
26719268 These results support a model in which EBNA2 and EBNA3s compete for distinct subsets of RBPJ sites to regulate cell genes and where EBNA3 subset specificity is determined by interactions with other cell transcription factors.
26655998 Suggest that hypoxia promotes SMO transcription through upregulation of MAML3 and RBPJ to induce proliferation, invasiveness and tumorigenesis in pancreatic cancer.
26604133 RBPJ polymorphism [rs874040(CC) allele] skews memory T cells toward a pro-inflammatory phenotype involving Notch signaling, thus increasing the susceptibility to develop rheumatoid arthritis.
26496776 The role of CSL-dependent and independent Notch signaling pathways in cell apoptosis is described in normal tissue homeostasis and in tumorigenesis. (Review)
26302407 Cancer-associated fibroblast activation-stromal co-evolution is under convergent CSL-p53 control.
26202358 data suggest that shRNA intervention of RBPJ expression could be a promising therapeutic approach for treating human prostate cancer
25589461 Our data thus suggest that shRNA intervention of RBPJ expression could be a promising therapeutic approach for treating human lung cancer.
25512468 Data indicate that RBPJ protein depletion induces Notch target genes in a Notch-independent fashion.
25445601 RBP-J-interacting and tubulin-associated (RITA) mediates the nuclear export of RBP-J to tubulin fibers and downregulates Notch-mediated transcription.
25324571 DNA methylation-dependent binding of RBPJ to a GC repressor element can negatively regulate smooth muscl myosin heavy chain promoter activity and can inhibit marker gene expression in phenotypically modulated cells
More...

AA Sequence

MDHTEGSPAEEPPAHAPSPGKFGERPPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSYGNEKRFFCPP      1 - 70
PCVYLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGKNYCTAKTLYISDSDKRKHFM     71 - 140
LSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKNADLCIASGTKVALFNRLRSQTVSTRYLHVEGGNF    141 - 210
HASSQQWGAFFIHLLDDDESEGEEFTVRDGYIHYGQTVKLVCSVTGMALPRLIIRKVDKQTALLDADDPV    211 - 280
SQLHKCAFYLKDTERMYLCLSQERIIQFQATPCPKEPNKEMINDGASWTIISTDKAEYTFYEGMGPVLAP    281 - 350
VTPVPVVESLQLNGGGDVAMLELTGQNFTPNLRVWFGDVEAETMYRCGESMLCVVPDISAFREGWRWVRQ    351 - 420
PVQVPVTLVRNDGIIYSTSLTFTYTPEPGPRPHCSAAGAILRANSSQVPPNESNTNSEGSYTNASTNSTS    421 - 490
VTSSTATVVS                                                                491 - 500
//

Text Mined References (112)

PMID Year Title
26719268 2015 Epstein-Barr Virus Nuclear Antigen 3 (EBNA3) Proteins Regulate EBNA2 Binding to Distinct RBPJ Genomic Sites.
26655998 2016 Hypoxia but not normoxia promotes Smoothened transcription through upregulation of RBPJ and Mastermind-like 3 in pancreatic cancer.
26604133 2016 Rheumatoid arthritis-associated RBPJ polymorphism alters memory CD4+ T cells.
26496776 2016 Role of CSL-dependent and independent Notch signaling pathways in cell apoptosis.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26302407 2015 Combined CSL and p53 downregulation promotes cancer-associated fibroblast activation.
26202358 2015 Inhibition of Recombining Binding Protein Suppressor of Hairless (RBPJ) Impairs the Growth of Prostate Cancer.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25589461 2015 RBPJ inhibition impairs the growth of lung cancer.
25512468 2015 Loss of the Notch effector RBPJ promotes tumorigenesis.
More...