Property Summary

NCBI Gene PubMed Count 121
PubMed Score 444.49
PubTator Score 275.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Adams-Oliver syndrome 15 4.208 2.1
Disease Target Count Z-score Confidence
Cancer 2499 4.001 2.0
Cadasil 10 3.51 1.8
Alagille syndrome 15 3.445 1.7

Expression

  Differential Expression (13)

Disease log2 FC p
acute quadriplegic myopathy 1.204 4.4e-07
Amyotrophic lateral sclerosis 1.022 5.7e-07
autosomal dominant Emery-Dreifuss muscul... 1.239 8.5e-04
dermatomyositis 1.300 1.3e-04
Down syndrome 1.100 8.0e-04
group 4 medulloblastoma 1.100 6.7e-03
interstitial cystitis -1.200 6.3e-04
invasive ductal carcinoma -1.100 2.0e-03
lung cancer 1.300 1.8e-02
ovarian cancer -1.700 1.6e-05
pancreatic ductal adenocarcinoma liver m... 1.037 9.1e-03
psoriasis -2.200 1.1e-04
tuberculosis -1.200 4.8e-07

Protein-protein Interaction (10)

Gene RIF (81)

AA Sequence

MDHTEGSPAEEPPAHAPSPGKFGERPPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSYGNEKRFFCPP      1 - 70
PCVYLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGKNYCTAKTLYISDSDKRKHFM     71 - 140
LSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKNADLCIASGTKVALFNRLRSQTVSTRYLHVEGGNF    141 - 210
HASSQQWGAFFIHLLDDDESEGEEFTVRDGYIHYGQTVKLVCSVTGMALPRLIIRKVDKQTALLDADDPV    211 - 280
SQLHKCAFYLKDTERMYLCLSQERIIQFQATPCPKEPNKEMINDGASWTIISTDKAEYTFYEGMGPVLAP    281 - 350
VTPVPVVESLQLNGGGDVAMLELTGQNFTPNLRVWFGDVEAETMYRCGESMLCVVPDISAFREGWRWVRQ    351 - 420
PVQVPVTLVRNDGIIYSTSLTFTYTPEPGPRPHCSAAGAILRANSSQVPPNESNTNSEGSYTNASTNSTS    421 - 490
VTSSTATVVS                                                                491 - 500
//

Text Mined References (125)

PMID Year Title