Property Summary

NCBI Gene PubMed Count 65
Grant Count 13
R01 Count 12
Funding $1,085,264.9
PubMed Score 54.58
PubTator Score 47.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Multiple myeloma 1.586 0.000
astrocytoma 1.100 0.015
glioblastoma 1.500 0.001
juvenile dermatomyositis 1.299 0.000
tuberculosis 1.300 0.000
lung cancer -1.100 0.001
ovarian cancer 1.500 0.002
dermatomyositis 1.100 0.008

 MGI Term (1)

Gene RIF (39)

PMID Text
26892607 Results show that PA28alpha was found to be overexpressed in oral squamous cell carcinoma cell lines and tumor tissues. High expression of PA28alpha was significantly associated with recurrence and poorer overall survival.
26399368 Constitutive expression of PA28 and ERAP1 in melanoma cells indicate that both interfere with MART-1(26-35) epitope generation even in the absence of IFN-gamma
23918357 PA28 is a tumor marker and a potential target for therapeutic intervention in prostate cancer.
23383295 Reduction in ATP levels triggers immunoproteasome activation by the 11S (PA28) regulator during early antiviral response mediated by IFNbeta in mouse pancreatic beta-cells.
22532226 the first evidence of a novel ovarian cancer-specific marker
19403671 HIV-1 CA downregulates PA28beta and the beta2i subunit of the immunoproteasome complex in a dendritic cell line (JAWS II), whereas in primary dendritic cells, PA28alpha, beta2i, and beta5i are downregulated by CA
19225532 bortezomib-adapted HL-60 cells showed increased expression and proteasome association of the 11S proteasome activator
17939699 the 11S proteasome activator complex, Reg alpha fragment, may have a role in ovarian cancer
17671684 DJ-1 and PA28alpha may have roles in the onset of hepatocarcinogenesis
14760793 The relationship between anti-PA28alpha and Ki antibodies suggests the importance of an antigen-driven system in the induction of an autoimmune response to PA28 complex.
More...

AA Sequence

MAMLRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDIPVPDPVK      1 - 70
EKEKEERKKQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIP     71 - 140
RIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYR    141 - 210
DIRLMVMEIRNAYAVLYDIILKNFEKLKKPRGETKGMIY                                   211 - 249
//

Text Mined References (71)

PMID Year Title
26892607 2016 Overexpression of proteasomal activator PA28? serves as a prognostic factor in oral squamous cell carcinoma.
26399368 2015 The proteasome immunosubunits, PA28 and ER-aminopeptidase 1 protect melanoma cells from efficient MART-126-35 -specific T-cell recognition.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23918357 2013 Proteasome activator complex PA28 identified as an accessible target in prostate cancer by in vivo selection of human antibodies.
23383295 2013 Reduction in ATP levels triggers immunoproteasome activation by the 11S (PA28) regulator during early antiviral response mediated by IFN? in mouse pancreatic ?-cells.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22532226 2012 The C-terminal fragment of the immunoproteasome PA28S (Reg alpha) as an early diagnosis and tumor-relapse biomarker: evidence from mass spectrometry profiling.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
More...