Property Summary

NCBI Gene PubMed Count 32
PubMed Score 418.59
PubTator Score 49.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
adrenocortical carcinoma -2.546 8.3e-06
adult high grade glioma 1.300 2.2e-03
aldosterone-producing adenoma -1.878 2.9e-02
Astrocytoma, Pilocytic 2.700 3.2e-10
Atopic dermatitis -1.500 3.9e-05
atypical teratoid / rhabdoid tumor 1.200 1.2e-03
breast carcinoma -1.200 9.5e-03
colon cancer -1.900 3.4e-07
cystic fibrosis 1.684 4.1e-05
ependymoma 1.700 3.8e-05
Gaucher disease type 3 -1.100 1.3e-02
glioblastoma 1.100 3.5e-03
intraductal papillary-mucinous adenoma (... -1.700 1.1e-03
intraductal papillary-mucinous carcinoma... -1.300 6.6e-03
intraductal papillary-mucinous neoplasm ... -1.500 2.1e-02
invasive ductal carcinoma -2.300 3.1e-02
lung adenocarcinoma -1.400 4.2e-09
lung cancer -2.200 3.2e-05
lung carcinoma -2.200 1.2e-11
malignant mesothelioma -4.100 6.5e-08
non-small cell lung cancer -1.311 2.3e-15
ovarian cancer -2.400 2.9e-16
pancreatic cancer -1.900 3.7e-05
pancreatic ductal adenocarcinoma liver m... -4.004 6.6e-04
pituitary cancer -1.200 1.7e-05

Gene RIF (17)

AA Sequence

MDRASELLFYVNGRKVIEKNVDPETMLLPYLRKKLRLTGTKYGCGGGGCGACTVMISRYNPITKRIRHHP      1 - 70
ANACLIPICSLYGAAVTTVEGIGSTHTRIHPVQERIAKCHGTQCGFCTPGMVMSIYTLLRNHPEPTLDQL     71 - 140
TDALGGNLCRCTGYRPIIDACKTFCKTSGCCQSKENGVCCLDQGINGLPEFEEGSKTSPKLFAEEEFLPL    141 - 210
DPTQELIFPPELMIMAEKQSQRTRVFGSERMMWFSPVTLKELLEFKFKYPQAPVIMGNTSVGPEVKFKGV    211 - 280
FHPVIISPDRIEELSVVNHAYNGLTLGAGLSLAQVKDILADVVQKLPEEKTQMYHALLKHLGTLAGSQIR    281 - 350
NMASLGGHIISRHPDSDLNPILAVGNCTLNLLSKEGKRQIPLNEQFLSKCPNADLKPQEILVSVNIPYSR    351 - 420
KWEFVSAFRQAQRQENALAIVNSGMRVFFGEGDGIIRELCISYGGVGPATICAKNSCQKLIGRHWNEQML    421 - 490
DIACRLILNEVSLLGSAPGGKVEFKRTLIISFLFKFYLEVSQILKKMDPVHYPSLADKYESALEDLHSKH    491 - 560
HCSTLKYQNIGPKQHPEDPIGHPIMHLSGVKHATGEAIYCDDMPLVDQELFLTFVTSSRAHAKIVSIDLS    561 - 630
EALSMPGVVDIMTAEHLSDVNSFCFFTEAEKFLATDKVFCVGQLVCAVLADSEVQAKRAAKRVKIVYQDL    631 - 700
EPLILTIEESIQHNSSFKPERKLEYGNVDEAFKVVDQILEGEIHMGGQEHFYMETQSMLVVPKGEDQEMD    701 - 770
VYVSTQFPKYIQDIVASTLKLPANKVMCHVRRVGGAFGGKVLKTGIIAAVTAFAANKHGRAVRCVLERGE    771 - 840
DMLITGGRHPYLGKYKAGFMNDGRILALDMEHYSNAGASLDESLFVIEMGLLKMDNAYKFPNLRCRGWAC    841 - 910
RTNLPSNTAFRGFGFPQAALITESCITEVAAKCGLSPEKVRIINMYKEIDQTPYKQEINAKNLIQCWREC    911 - 980
MAMSSYSLRKVAVEKFNAENYWKKKGLAMVPLKFPVGLGSRAAGQAAALVHIYLDGSVLVTHGGIEMGQG    981 - 1050
VHTKMIQVVSRELRMPMSNVHLRGTSTETVPNANISGGSVVADLNGLAVKDACQTLLKRLEPIISKNPKG   1051 - 1120
TWKDWAQTAFDESINLSAVGYFRGYESDMNWEKGEGQPFEYFVYGAACSEVEIDCLTGDHKNIRTDIVMD   1121 - 1190
VGCSINPAIDIGQIEGAFIQGMGLYTIEELNYSPQGILHTRGPDQYKIPAICDMPTELHIALLPPSQNSN   1191 - 1260
TLYSSKGLGESGVFLGCSVFFAIHDAVSAARQERGLHGPLTLNSPLTPEKIRMACEDKFTKMIPRDEPGS   1261 - 1330
YVPWNVPI                                                                 1331 - 1338
//

Text Mined References (41)

PMID Year Title