Property Summary

NCBI Gene PubMed Count 26
Grant Count 32
R01 Count 22
Funding $3,109,475.4
PubMed Score 413.24
PubTator Score 49.84

Knowledge Summary

Patent

No data available

Expression

Gene RIF (15)

PMID Text
26032640 Methotrexate is poorly metabolized by human AOX1, in contrast to rabbit.
25845827 Data suggest that substrate specificity of AOX1 includes GDC-0834, an inhibitor of Bruton's tyrosine kinase with potential non-steroidal anti-inflammatory agent activity; in liver cytosol, hydrolysis of GDC-0834 is primarily due to AOX1.
25537183 These results supported the possibility that XO/XD and AO can contribute to nitric oxide generation.
23918943 High AOX1 methylation was associated with biochemical recurrence in prostate cancer.
23857892 Several donors have a normal AOX1 protein level.
22522748 hydralazine, at a concentration of 25 to 50 muM, can be used in human hepatocyte incubations to estimate the contribution of aldehyde oxidase to the hepatic clearance of drugs and other compounds.
22495427 The physiological role of AOX1 remains unclear, but it is known that thiopurines belong to its substrates; AOX1 contributes to azathioprine catabolism.
22279051 Human population is characterized by the presence of functionally inactive hAOX1 allelic variants as well as variants encoding enzymes with different catalytic activities.
22031625 characterization of AO activity in cryopreserved human hepatocytes: enzyme stability; substrate specificity; kinetics; inhibition by hydralazine
20800603 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MDRASELLFYVNGRKVIEKNVDPETMLLPYLRKKLRLTGTKYGCGGGGCGACTVMISRYNPITKRIRHHP      1 - 70
ANACLIPICSLYGAAVTTVEGIGSTHTRIHPVQERIAKCHGTQCGFCTPGMVMSIYTLLRNHPEPTLDQL     71 - 140
TDALGGNLCRCTGYRPIIDACKTFCKTSGCCQSKENGVCCLDQGINGLPEFEEGSKTSPKLFAEEEFLPL    141 - 210
DPTQELIFPPELMIMAEKQSQRTRVFGSERMMWFSPVTLKELLEFKFKYPQAPVIMGNTSVGPEVKFKGV    211 - 280
FHPVIISPDRIEELSVVNHAYNGLTLGAGLSLAQVKDILADVVQKLPEEKTQMYHALLKHLGTLAGSQIR    281 - 350
NMASLGGHIISRHPDSDLNPILAVGNCTLNLLSKEGKRQIPLNEQFLSKCPNADLKPQEILVSVNIPYSR    351 - 420
KWEFVSAFRQAQRQENALAIVNSGMRVFFGEGDGIIRELCISYGGVGPATICAKNSCQKLIGRHWNEQML    421 - 490
DIACRLILNEVSLLGSAPGGKVEFKRTLIISFLFKFYLEVSQILKKMDPVHYPSLADKYESALEDLHSKH    491 - 560
HCSTLKYQNIGPKQHPEDPIGHPIMHLSGVKHATGEAIYCDDMPLVDQELFLTFVTSSRAHAKIVSIDLS    561 - 630
EALSMPGVVDIMTAEHLSDVNSFCFFTEAEKFLATDKVFCVGQLVCAVLADSEVQAKRAAKRVKIVYQDL    631 - 700
EPLILTIEESIQHNSSFKPERKLEYGNVDEAFKVVDQILEGEIHMGGQEHFYMETQSMLVVPKGEDQEMD    701 - 770
VYVSTQFPKYIQDIVASTLKLPANKVMCHVRRVGGAFGGKVLKTGIIAAVTAFAANKHGRAVRCVLERGE    771 - 840
DMLITGGRHPYLGKYKAGFMNDGRILALDMEHYSNAGASLDESLFVIEMGLLKMDNAYKFPNLRCRGWAC    841 - 910
RTNLPSNTAFRGFGFPQAALITESCITEVAAKCGLSPEKVRIINMYKEIDQTPYKQEINAKNLIQCWREC    911 - 980
MAMSSYSLRKVAVEKFNAENYWKKKGLAMVPLKFPVGLGSRAAGQAAALVHIYLDGSVLVTHGGIEMGQG    981 - 1050
VHTKMIQVVSRELRMPMSNVHLRGTSTETVPNANISGGSVVADLNGLAVKDACQTLLKRLEPIISKNPKG   1051 - 1120
TWKDWAQTAFDESINLSAVGYFRGYESDMNWEKGEGQPFEYFVYGAACSEVEIDCLTGDHKNIRTDIVMD   1121 - 1190
VGCSINPAIDIGQIEGAFIQGMGLYTIEELNYSPQGILHTRGPDQYKIPAICDMPTELHIALLPPSQNSN   1191 - 1260
TLYSSKGLGESGVFLGCSVFFAIHDAVSAARQERGLHGPLTLNSPLTPEKIRMACEDKFTKMIPRDEPGS   1261 - 1330
YVPWNVPI                                                                 1331 - 1338
//

Text Mined References (37)

PMID Year Title
26032640 2015 Interspecies differences in the metabolism of methotrexate: An insight into the active site differences between human and rabbit aldehyde oxidase.
25845827 2015 A novel reaction mediated by human aldehyde oxidase: amide hydrolysis of GDC-0834.
25537183 2015 Nitrite reductase activity of rat and human xanthine oxidase, xanthine dehydrogenase, and aldehyde oxidase: evaluation of their contribution to NO formation in vivo.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23918943 2013 DNA methylation signatures for prediction of biochemical recurrence after radical prostatectomy of clinically localized prostate cancer.
23857892 2013 Aldehyde oxidase 1 (AOX1) in human liver cytosols: quantitative characterization of AOX1 expression level and activity relationship.
23263164 2013 Structure and evolution of vertebrate aldehyde oxidases: from gene duplication to gene suppression.
22996261 2013 Evidence for substrate-dependent inhibition profiles for human liver aldehyde oxidase.
22522748 2012 Hydralazine as a selective probe inactivator of aldehyde oxidase in human hepatocytes: estimation of the contribution of aldehyde oxidase to metabolic clearance.
22495427 2012 Polymorphism of genes involved in purine metabolism (XDH, AOX1, MOCOS) in kidney transplant recipients receiving azathioprine.
More...