Property Summary

NCBI Gene PubMed Count 25
Grant Count 4
R01 Count 1
Funding $535,213.31
PubMed Score 13.53
PubTator Score 60.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis -2.700 0.000
osteosarcoma -1.753 0.000
lung cancer 1.800 0.002
group 3 medulloblastoma 1.200 0.000
ovarian cancer 1.300 0.000

Synonym

Accession Q06265 Q12883 Q4W5P5 Q86Y41 Q86Y48
Symbols p5
p6
RRP45
PMSCL1
Rrp45p
PM/Scl-75

Gene

PDB

2NN6  

 MGI Term (1)

Gene RIF (5)

PMID Text
17545563 Although not required for exosome stability, PM/Scl-100 and PM/Scl-75 are involved in mRNA degradation.
14872500 PM-Scl-75 is the main autoantigen in patients with the polymyositis/scleroderma overlap syndrome.
12788944 The association of the human PM/Scl-75 autoantigen with the exosome is dependent on a newly identified N terminus.
12419256 Protein-protein interactions between human exosome components support the assembly of RNase PH-type subunits into a six-membered PNPase-like ring.
11782436 The mammalian exosome mediates the efficient degradation of mRNAs that contain AU-rich elements, possibly by direct binding of PM/Scl-75 to these RNA regions.

AA Sequence

MKETPLSNCERRFLLRAIEEKKRLDGRQTYDYRNIRISFGTDYGCCIVELGKTRVLGQVSCELVSPKLNR      1 - 70
ATEGILFFNLELSQMAAPAFEPGRQSDLLVKLNRLMERCLRNSKCIDTESLCVVAGEKVWQIRVDLHLLN     71 - 140
HDGNIIDAASIAAIVALCHFRRPDVSVQGDEVTLYTPEERDPVPLSIHHMPICVSFAFFQQGTYLLVDPN    141 - 210
EREERVMDGLLVIAMNKHREICTIQSSGGIMLLKDQVLRCSKIAGVKVAEITELILKALENDQKVRKEGG    211 - 280
KFGFAESIANQRITAFKMEKAPIDTSDVEEKAEEIIAEAEPPSEVVSTPVLWTPGTAQIGEGVENSWGDL    281 - 350
EDSEKEDDEGGGDQAIILDGIKMDTGVEVSDIGSQDAPIILSDSEEEEMIILEPDKNPKKIRTQTTSAKQ    351 - 420
EKAPSKKPVKRRKKKRAAN                                                       421 - 439
//

Text Mined References (41)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24105744 2013 A SUMO-dependent interaction between Senataxin and the exosome, disrupted in the neurodegenerative disease AOA2, targets the exosome to sites of transcription-induced DNA damage.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22791713 2012 Phosphatase of regenerating liver 2 (PRL2) is essential for placental development by down-regulating PTEN (Phosphatase and Tensin Homologue Deleted on Chromosome 10) and activating Akt protein.
More...