Property Summary

NCBI Gene PubMed Count 26
PubMed Score 13.53
PubTator Score 60.32

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma 1.200 2.5e-04
lung cancer 1.800 2.2e-03
osteosarcoma -1.753 4.2e-06
ovarian cancer 1.300 6.2e-06
psoriasis -2.700 6.2e-06

 MGI Phenotype (1)

Gene RIF (5)

AA Sequence

MKETPLSNCERRFLLRAIEEKKRLDGRQTYDYRNIRISFGTDYGCCIVELGKTRVLGQVSCELVSPKLNR      1 - 70
ATEGILFFNLELSQMAAPAFEPGRQSDLLVKLNRLMERCLRNSKCIDTESLCVVAGEKVWQIRVDLHLLN     71 - 140
HDGNIIDAASIAAIVALCHFRRPDVSVQGDEVTLYTPEERDPVPLSIHHMPICVSFAFFQQGTYLLVDPN    141 - 210
EREERVMDGLLVIAMNKHREICTIQSSGGIMLLKDQVLRCSKIAGVKVAEITELILKALENDQKVRKEGG    211 - 280
KFGFAESIANQRITAFKMEKAPIDTSDVEEKAEEIIAEAEPPSEVVSTPVLWTPGTAQIGEGVENSWGDL    281 - 350
EDSEKEDDEGGGDQAIILDGIKMDTGVEVSDIGSQDAPIILSDSEEEEMIILEPDKNPKKIRTQTTSAKQ    351 - 420
EKAPSKKPVKRRKKKRAAN                                                       421 - 439
//

Text Mined References (43)

PMID Year Title