Property Summary

NCBI Gene PubMed Count 25
PubMed Score 13.53
PubTator Score 60.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 4.19223701981666E-6
ovarian cancer 8492 6.17432120523125E-6
psoriasis 6685 6.1953182728643E-6
group 3 medulloblastoma 2254 2.4575252740359E-4
lung cancer 4473 0.00217735391331744

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis -2.700 0.000
osteosarcoma -1.753 0.000
lung cancer 1.800 0.002
group 3 medulloblastoma 1.200 0.000
ovarian cancer 1.300 0.000

Synonym

Accession Q06265 Q12883 Q4W5P5 Q86Y41 Q86Y48
Symbols p5
p6
RRP45
PMSCL1
Rrp45p
PM/Scl-75

Gene

PDB

2NN6  

  Ortholog (14)

Species Source
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae EggNOG Inparanoid

 MGI Term (1)

Gene RIF (5)

PMID Text
17545563 Although not required for exosome stability, PM/Scl-100 and PM/Scl-75 are involved in mRNA degradation.
14872500 PM-Scl-75 is the main autoantigen in patients with the polymyositis/scleroderma overlap syndrome.
12788944 The association of the human PM/Scl-75 autoantigen with the exosome is dependent on a newly identified N terminus.
12419256 Protein-protein interactions between human exosome components support the assembly of RNase PH-type subunits into a six-membered PNPase-like ring.
11782436 The mammalian exosome mediates the efficient degradation of mRNAs that contain AU-rich elements, possibly by direct binding of PM/Scl-75 to these RNA regions.

AA Sequence

MKETPLSNCERRFLLRAIEEKKRLDGRQTYDYRNIRISFGTDYGCCIVELGKTRVLGQVSCELVSPKLNR      1 - 70
ATEGILFFNLELSQMAAPAFEPGRQSDLLVKLNRLMERCLRNSKCIDTESLCVVAGEKVWQIRVDLHLLN     71 - 140
HDGNIIDAASIAAIVALCHFRRPDVSVQGDEVTLYTPEERDPVPLSIHHMPICVSFAFFQQGTYLLVDPN    141 - 210
EREERVMDGLLVIAMNKHREICTIQSSGGIMLLKDQVLRCSKIAGVKVAEITELILKALENDQKVRKEGG    211 - 280
KFGFAESIANQRITAFKMEKAPIDTSDVEEKAEEIIAEAEPPSEVVSTPVLWTPGTAQIGEGVENSWGDL    281 - 350
EDSEKEDDEGGGDQAIILDGIKMDTGVEVSDIGSQDAPIILSDSEEEEMIILEPDKNPKKIRTQTTSAKQ    351 - 420
EKAPSKKPVKRRKKKRAAN                                                       421 - 439
//

Text Mined References (41)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24105744 2013 A SUMO-dependent interaction between Senataxin and the exosome, disrupted in the neurodegenerative disease AOA2, targets the exosome to sites of transcription-induced DNA damage.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22791713 2012 Phosphatase of regenerating liver 2 (PRL2) is essential for placental development by down-regulating PTEN (Phosphatase and Tensin Homologue Deleted on Chromosome 10) and activating Akt protein.
More...