Property Summary

NCBI Gene PubMed Count 17
PubMed Score 0.00
PubTator Score 7.33

Knowledge Summary

Patent

No data available

Synonym

Accession Q06250 Q4KMY0 Q96A27 WIT-1
Symbols WIT1
WIT-1
WT1AS
WT1-AS1

Gene

 Compartment GO Term (1)

Gene RIF (4)

AA Sequence

MQRRGQPLENHVALIHWQSAGIPASKVHNYCNMKKSRLGRSRAVRISQPLLSPRRCPLHLTERGAGLLQP      1 - 70
QPQGPVRTPGPPSGSHPAAADN                                                     71 - 92
//

Text Mined References (17)

PMID Year Title