Property Summary

NCBI Gene PubMed Count 17
PubMed Score 0.00
PubTator Score 7.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Synonym

Accession Q06250 Q4KMY0 Q96A27 WIT-1
Symbols WIT1
WIT-1
WT1AS
WT1-AS1

Gene

 Compartment GO Term (1)

Gene RIF (4)

PMID Text
26462627 WT1-AS downregulates WT1 expression in hepatocellular carcinoma tumors and promotes apoptosis by binding to the promoter region of WT1. WT1-AS may function as a tumor suppressor in hepatocellular carcinoma by reversing the oncogenic effects of WT1.
24707949 Data suggest that WT1-as, MEG3 and ANRIL could potentially be used as new primary myelofibrosis (PMF) diagnostic biomarkers with prognostic implications.
17210670 WT1 and WT1AS (WT1 antisense RNA) genes are imprinted in human kidney, with preferential expression from the paternal allele, and imprinting defects at chromosome 11p13 may contribute to Wilms' tumourigenesis.
15687485 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MQRRGQPLENHVALIHWQSAGIPASKVHNYCNMKKSRLGRSRAVRISQPLLSPRRCPLHLTERGAGLLQP      1 - 70
QPQGPVRTPGPPSGSHPAAADN                                                     71 - 92
//

Text Mined References (17)

PMID Year Title
26462627 2015 WT1-AS promotes cell apoptosis in hepatocellular carcinoma through down-regulating of WT1.
25416956 2014 A proteome-scale map of the human interactome network.
24707949 2015 Abnormal expression patterns of WT1-as, MEG3 and ANRIL long non-coding RNAs in CD34+ cells from patients with primary myelofibrosis and their clinical correlations.
17940140 2007 Alternately spliced WT1 antisense transcripts interact with WT1 sense RNA and show epigenetic and splicing defects in cancer.
17210670 2007 A CTCF-binding silencer regulates the imprinted genes AWT1 and WT1-AS and exhibits sequential epigenetic defects during Wilms' tumourigenesis.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16134181 2005 WT1 and WT1-AS genes are inactivated by promoter methylation in ovarian clear cell adenocarcinoma.
15687485 2005 Variants in the Wilms' tumor gene are associated with focal segmental glomerulosclerosis in the African American population.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...